Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8817
Gene name	Fibroblast growth factor 18
Gene symbol	FGF18
Synonyms (NCBI Gene)	FGF-18ZFGF5
Chromosome	5
Chromosome location	5q35.1
Summary	The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1441510334	C>T	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments
MIRT995607	hsa-miR-122	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT995609	hsa-miR-3192	CLIP-seq
MIRT995610	hsa-miR-3659	CLIP-seq
MIRT995611	hsa-miR-369-3p	CLIP-seq
MIRT995612	hsa-miR-374a	CLIP-seq
MIRT995613	hsa-miR-374b	CLIP-seq
MIRT995614	hsa-miR-4314	CLIP-seq
MIRT995615	hsa-miR-4328	CLIP-seq
MIRT995616	hsa-miR-4646-5p	CLIP-seq
MIRT995617	hsa-miR-4658	CLIP-seq
MIRT995618	hsa-miR-4753-3p	CLIP-seq
MIRT995619	hsa-miR-574-5p	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT1921433	hsa-miR-3942-3p	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT1921433	hsa-miR-3942-3p	CLIP-seq
MIRT995608	hsa-miR-129-5p	CLIP-seq
MIRT1921433	hsa-miR-3942-3p	CLIP-seq
MIRT995615	hsa-miR-4328	CLIP-seq
MIRT995619	hsa-miR-574-5p	CLIP-seq
MIRT2449659	hsa-miR-3153	CLIP-seq
MIRT2449660	hsa-miR-4278	CLIP-seq
MIRT2449661	hsa-miR-4668-5p	CLIP-seq
MIRT2449662	hsa-miR-4716-3p	CLIP-seq
MIRT2449663	hsa-miR-4723-5p	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	16756958
GO:0001957	Process	Intramembranous ossification	IEA
GO:0001958	Process	Endochondral ossification	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0002063	Process	Chondrocyte development	IEA
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IBA
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IDA	16384934
GO:0005105	Function	Type 1 fibroblast growth factor receptor binding	IEA
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IBA
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IDA	16384934
GO:0005111	Function	Type 2 fibroblast growth factor receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	9742123
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	TAS	9742123
GO:0007267	Process	Cell-cell signaling	TAS	9742123
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	9742123
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	9742123
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9742123
GO:0022008	Process	Neurogenesis	IBA
GO:0030324	Process	Lung development	IEA
GO:0030334	Process	Regulation of cell migration	IBA
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	16756958
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IGI	25449503
GO:0045766	Process	Positive regulation of angiogenesis	IGI	25449503
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903670	Process	Regulation of sprouting angiogenesis	IDA	16756958
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958

MIM	HGNC	e!Ensembl
603726	3674	ENSG00000156427

O76093

Protein name

Fibroblast growth factor 18 (FGF-18) (zFGF5)

Protein function

Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.

PDB

4CJM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	53 → 175	Fibroblast growth factor	Domain

Sequence

MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQPELQKPFKYTTVTKRSRRIRPTHPA

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Pathways in cancer Chemical carcinogenesis - receptor activation Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR3b ligand binding and activation FGFR3c ligand binding and activation FGFR2c ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease FGFRL1 modulation of FGFR1 signaling RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Short stature	Uncertain significance	rs1441510334	RCV000736147

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Stimulate	26427667
Adenocarcinoma	Associate	31527546
Adenoma	Associate	24619956
Alopecia Areata	Associate	20546884
Breast Neoplasms	Associate	23648477, 30196303
Cartilage Diseases	Stimulate	36463522
Colonic Diseases	Associate	24619956
Colorectal Neoplasms	Associate	20234367, 24619956, 29713043, 33034614, 35587572
Dyslexia	Associate	23190410
Femoracetabular Impingement	Stimulate	36463522
Fibrosis	Associate	31630548
Hereditary Angioedema Types I and II	Associate	26427667
Hypoxia Brain	Associate	30196303
Idiopathic Pulmonary Fibrosis	Associate	26773067
Melanoma	Associate	21753785
Mesothelioma Malignant	Associate	37340889
Myocardial Infarction	Associate	29713043
Neoplasm Metastasis	Associate	30196303
Neoplasms	Associate	24619956, 26427667, 31527546, 39969322
Neoplasms Cystic Mucinous and Serous	Associate	26427667
Netherton Syndrome	Associate	19727229
Obesity	Associate	29713043
Orofacial Cleft 1	Associate	19727229
Osteoarthritis	Associate	30664745, 33125858
Osteolysis	Inhibit	17729302
Ovarian Diseases	Associate	26427667
Ovarian Neoplasms	Associate	24146310, 26427667, 32878513
Ovarian Neoplasms	Stimulate	39385288
Precancerous Conditions	Associate	30196303
Squamous Cell Carcinoma of Head and Neck	Associate	26683928
Stomach Neoplasms	Associate	31527546

FGF18 (fibroblast growth factor 18)