GALR2 (galanin receptor 2)

Gene

• Entrez ID: 8811
• Gene name: Galanin receptor 2
• Gene symbol: GALR2
• Synonyms (NCBI Gene): GAL2-R, GALNR2, GALR-2
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: Galanin is an important neuromodulator present in the brain, gastrointestinal system, and hypothalamopituitary axis. It is a 30-amino acid non-C-terminally amidated peptide that potently stimulates growth hormone secretion, inhibits cardiac vagal slowing

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030137	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	IBA
GO:0004966	Function	Galanin receptor activity	IDA	9480833, 9832121, 24517231
GO:0004966	Function	Galanin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	23597562, 25691535
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9480833
GO:0005929	Component	Cilium	IDA	28154160
GO:0006936	Process	Muscle contraction	TAS	9480833
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	9685625
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	9832121
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9685625
GO:0007611	Process	Learning or memory	TAS	9480833
GO:0007631	Process	Feeding behavior	TAS	9480833
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9480833
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0017046	Function	Peptide hormone binding	IPI	9832121
GO:0031175	Process	Neuron projection development	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0043647	Process	Inositol phosphate metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0090663	Process	Galanin-activated signaling pathway	IBA
GO:0090663	Process	Galanin-activated signaling pathway	IDA	9480833, 9832121
GO:0090663	Process	Galanin-activated signaling pathway	IMP	24602615

Other IDs

• MIM: 603691
• HGNC: 4133
• e!Ensembl: ENSG00000182687

Protein

• UniProt ID: O43603
• Protein name: Galanin receptor type 2 (GAL2-R) (GALR-2)
• Protein function: Receptor for the hormone galanin and GALP. Receptor for the hormone spexin-1 (PubMed:24517231). The activity of this receptor is mediated by G proteins that activate the phospholipase C/protein kinase C pathway (via G(q)) and that inhibit adenyl
• PDB: 7WQ4, 7XBD, 7XJK, 7XJL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	42 → 292	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed abundantly within the central nervous system in both hypothalamus and hippocampus. In peripheral tissues, the strongest expression was observed in heart, kidney, liver, and small intestine.
• Sequence:

  MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
  NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
  LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
  APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
  VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
  KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
  PCILEPCPGPSWQGPKAGDSILTVDVA

• Sequence length: 387

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

<