Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8811
Gene name Gene Name - the full gene name approved by the HGNC.	Galanin receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GALR2
Synonyms (NCBI Gene) Gene synonyms aliases	GAL2-R, GALNR2, GALR-2
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	Galanin is an important neuromodulator present in the brain, gastrointestinal system, and hypothalamopituitary axis. It is a 30-amino acid non-C-terminally amidated peptide that potently stimulates growth hormone secretion, inhibits cardiac vagal slowing

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030137	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004966	Function	Galanin receptor activity	IBA	21873635
GO:0004966	Function	Galanin receptor activity	IDA	9832121, 24517231
GO:0005515	Function	Protein binding	IPI	23597562, 25691535
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005929	Component	Cilium	IDA	28154160
GO:0006936	Process	Muscle contraction	TAS	9480833
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9480833
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007194	Process	Negative regulation of adenylate cyclase activity	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	9832121
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007275	Process	Multicellular organism development	TAS	9480833
GO:0007611	Process	Learning or memory	TAS	9480833
GO:0007631	Process	Feeding behavior	TAS	9480833
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	TAS	9480833
GO:0017046	Function	Peptide hormone binding	IDA	24517231
GO:0017046	Function	Peptide hormone binding	IPI	9832121
GO:0031175	Process	Neuron projection development	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0043647	Process	Inositol phosphate metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24517231
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0090663	Process	Galanin-activated signaling pathway	IDA	9832121
GO:1902608	Process	Positive regulation of large conductance calcium-activated potassium channel activity	IMP	24602615

MIM	HGNC	e!Ensembl
603691	4133	ENSG00000182687

Protein

UniProt ID

O43603

Protein name

Galanin receptor type 2 (GAL2-R) (GALR-2)

Protein function

Receptor for the hormone galanin and GALP. Receptor for the hormone spexin-1 (PubMed:24517231). The activity of this receptor is mediated by G proteins that activate the phospholipase C/protein kinase C pathway (via G(q)) and that inhibit adenyl

PDB

7WQ4 , 7XBD , 7XJK , 7XJL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	42 → 292	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed abundantly within the central nervous system in both hypothalamus and hippocampus. In peripheral tissues, the strongest expression was observed in heart, kidney, liver, and small intestine.

Sequence

MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT
NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS
LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS
APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI
VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR
KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ
PCILEPCPGPSWQGPKAGDSILTVDVA

Sequence length

387

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Depressive disorder, Unipolar Depression, Major Depressive Disorder		21672612, 18554714, 27940914	ClinVar

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	27896617
Anxiety	Associate	24706871
Breast Neoplasms	Associate	18446232
Carcinoma Adenoid Cystic	Associate	36039037
Colorectal Neoplasms	Associate	18446232, 36551197
Depressive Disorder	Associate	24706871
Head and Neck Neoplasms	Associate	24122450, 27685843
Neoplasms	Inhibit	19276245, 24122450, 24168112
Neuroblastoma	Associate	19276245
Obesity	Associate	37658762
Polycystic Ovary Syndrome	Stimulate	37658762
Small Cell Lung Carcinoma	Stimulate	19276245
Squamous Cell Carcinoma of Head and Neck	Associate	24168112, 25734919, 27685843, 35267186
Tarlov Cysts	Associate	36039037

GALR2 (galanin receptor 2)