Gene Gene information from NCBI Gene database.
Entrez ID 8795
Gene name TNF receptor superfamily member 10b
Gene symbol TNFRSF10B
Synonyms (NCBI Gene)
CD262DR5KILLERKILLER/DR5TRAIL-R2TRAILR2TRICK2TRICK2ATRICK2BTRICKBZTNFR9
Chromosome 8
Chromosome location 8p21.3
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an a
miRNA miRNA information provided by mirtarbase database.
1334
miRTarBase ID miRNA Experiments Reference
MIRT005122 hsa-miR-30a-5p pSILAC 18668040
MIRT019597 hsa-miR-340-5p Sequencing 20371350
MIRT005122 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT050973 hsa-miR-17-5p CLASH 23622248
MIRT049847 hsa-miR-92a-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
23
Transcription factor Regulation Reference
ATF4 Unknown 21044953
ATM Repression 19351839
DDIT3 Activation 15322075;15994939;18593935;18794136;21044953;21726997;21941003
DDIT3 Repression 18172319;21941003
DDIT3 Unknown 20157774;22328338
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0002357 Process Defense response to tumor cell IDA 28362429
GO:0005035 Function Death receptor activity IEA
GO:0005515 Function Protein binding IPI 10549288, 18846110, 19427028, 20097879, 20103630, 21459798, 21525171, 21822306, 22266862, 23678861, 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 17462628
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603612 11905 ENSG00000120889
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14763
Protein name Tumor necrosis factor receptor superfamily member 10B (Death receptor 5) (TNF-related apoptosis-inducing ligand receptor 2) (TRAIL receptor 2) (TRAIL-R2) (CD antigen CD262)
Protein function Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:10549288). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which init
PDB 1D0G , 1D4V , 1DU3 , 1ZA3 , 2H9G , 3X3F , 4I9X , 4N90 , 4OD2 , 6NHW , 6NHY , 6T3J , 8DPX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 97 137 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 139 178 TNFR/NGFR cysteine-rich region Domain
PF00531 Death 339 422 Death domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, pros
Sequence
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVC
QCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HL
LSSGKFMYLEGNADSAMS
Sequence length 440
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
p53 signaling pathway
Apoptosis
Necroptosis
Natural killer cell mediated cytotoxicity
Pathogenic Escherichia coli infection
Salmonella infection
Influenza A
Lipid and atherosclerosis
  Caspase activation via Death Receptors in the presence of ligand
Cell surface interactions at the vascular wall
Regulation by c-FLIP
RIPK1-mediated regulated necrosis
CASP8 activity is inhibited
TP53 Regulates Transcription of Death Receptors and Ligands
Dimerization of procaspase-8
TRAIL signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
15
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Squamous cell carcinoma of the head and neck Likely pathogenic; Pathogenic rs757683917, rs772964680 RCV003993592
RCV000006571
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia - rs41308110 RCV006014983
Clear cell carcinoma of kidney - rs41308110 RCV006014984
Lung cancer - rs41308110 RCV006014986
Melanoma - rs41308110 RCV006014985
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 31638235
Adenocarcinoma Associate 35328735
Adenocarcinoma Bronchiolo Alveolar Associate 18457325
Adenocarcinoma of Lung Associate 31638235
Adenoma Associate 19293270
Alzheimer Disease Associate 22695614
Anemia Pernicious Associate 6783164
Arthritis Juvenile Associate 10513798, 3488035, 6610178
Arthritis Rheumatoid Associate 15457446, 36675245
Arthritis Rheumatoid Stimulate 19171073