Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	8794
Gene name	TNF receptor superfamily member 10c
Gene symbol	TNFRSF10C
Synonyms (NCBI Gene)	CD263DCR1DCR1-TNFRLITTRAIL-R3TRAILR3TRID
Chromosome	8
Chromosome location	8p21.3
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT1442774	hsa-miR-1292	CLIP-seq
MIRT1442775	hsa-miR-1321	CLIP-seq
MIRT1442776	hsa-miR-1827	CLIP-seq
MIRT1442777	hsa-miR-1909	CLIP-seq
MIRT1442778	hsa-miR-2467-3p	CLIP-seq
MIRT1442779	hsa-miR-3126-5p	CLIP-seq
MIRT1442780	hsa-miR-3199	CLIP-seq
MIRT1442781	hsa-miR-3612	CLIP-seq
MIRT1442782	hsa-miR-361-3p	CLIP-seq
MIRT1442783	hsa-miR-4260	CLIP-seq
MIRT1442784	hsa-miR-4267	CLIP-seq
MIRT1442785	hsa-miR-4419a	CLIP-seq
MIRT1442786	hsa-miR-4436b-3p	CLIP-seq
MIRT1442787	hsa-miR-4471	CLIP-seq
MIRT1442788	hsa-miR-4510	CLIP-seq
MIRT1442789	hsa-miR-4648	CLIP-seq
MIRT1442790	hsa-miR-4654	CLIP-seq
MIRT1442791	hsa-miR-4688	CLIP-seq
MIRT1442792	hsa-miR-4733-3p	CLIP-seq
MIRT1442793	hsa-miR-4739	CLIP-seq
MIRT1442794	hsa-miR-4740-5p	CLIP-seq
MIRT1442795	hsa-miR-4756-5p	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442797	hsa-miR-4768-3p	CLIP-seq
MIRT1442798	hsa-miR-4769-5p	CLIP-seq
MIRT1442799	hsa-miR-486-3p	CLIP-seq
MIRT1442800	hsa-miR-650	CLIP-seq
MIRT1442801	hsa-miR-665	CLIP-seq
MIRT1442802	hsa-miR-922	CLIP-seq
MIRT1442803	hsa-miR-940	CLIP-seq
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT1442774	hsa-miR-1292	CLIP-seq
MIRT2132513	hsa-miR-3120-5p	CLIP-seq
MIRT1442787	hsa-miR-4471	CLIP-seq
MIRT1442789	hsa-miR-4648	CLIP-seq
MIRT1442790	hsa-miR-4654	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442798	hsa-miR-4769-5p	CLIP-seq
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT2693662	hsa-miR-1254	CLIP-seq
MIRT2693663	hsa-miR-1291	CLIP-seq
MIRT1442775	hsa-miR-1321	CLIP-seq
MIRT1442776	hsa-miR-1827	CLIP-seq
MIRT2693664	hsa-miR-193a-3p	CLIP-seq
MIRT2693665	hsa-miR-193b	CLIP-seq
MIRT1442778	hsa-miR-2467-3p	CLIP-seq
MIRT2693666	hsa-miR-2861	CLIP-seq
MIRT2693667	hsa-miR-3064-5p	CLIP-seq
MIRT2693668	hsa-miR-3116	CLIP-seq
MIRT2693669	hsa-miR-3173-5p	CLIP-seq
MIRT2693670	hsa-miR-328	CLIP-seq
MIRT1442781	hsa-miR-3612	CLIP-seq
MIRT2693671	hsa-miR-3652	CLIP-seq
MIRT2693672	hsa-miR-3689a-3p	CLIP-seq
MIRT2693673	hsa-miR-3689c	CLIP-seq
MIRT2693674	hsa-miR-3928	CLIP-seq
MIRT2693675	hsa-miR-4290	CLIP-seq
MIRT2693676	hsa-miR-4313	CLIP-seq
MIRT2693677	hsa-miR-432	CLIP-seq
MIRT1442785	hsa-miR-4419a	CLIP-seq
MIRT2693678	hsa-miR-4426	CLIP-seq
MIRT2693679	hsa-miR-4430	CLIP-seq
MIRT1442786	hsa-miR-4436b-3p	CLIP-seq
MIRT2693680	hsa-miR-4505	CLIP-seq
MIRT1442788	hsa-miR-4510	CLIP-seq
MIRT2693681	hsa-miR-4647	CLIP-seq
MIRT2693682	hsa-miR-4662b	CLIP-seq
MIRT2693683	hsa-miR-4699-5p	CLIP-seq
MIRT2693684	hsa-miR-4728-5p	CLIP-seq
MIRT1442793	hsa-miR-4739	CLIP-seq
MIRT1442795	hsa-miR-4756-5p	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442800	hsa-miR-650	CLIP-seq
MIRT2693685	hsa-miR-661	CLIP-seq
MIRT1442802	hsa-miR-922	CLIP-seq
MIRT1442803	hsa-miR-940	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9314565
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9314565
GO:0006915	Process	Apoptotic process	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0045569	Function	TRAIL binding	IEA
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
603613	11906	ENSG00000173535

O14798

Protein name

Tumor necrosis factor receptor superfamily member 10C (Antagonist decoy receptor for TRAIL/Apo-2L) (Decoy TRAIL receptor without death domain) (Decoy receptor 1) (DcR1) (Lymphocyte inhibitor of TRAIL) (TNF-related apoptosis-inducing ligand receptor 3) (TR

Protein function

Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	69 → 109	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	111 → 149	TNFR/NGFR cysteine-rich region	Domain

Tissue specificity

TISSUE SPECIFICITY: Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Sequence

MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY
LSCTIVGIIVLIVLLIVFV

Sequence length

259

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor		TP53 Regulates Transcription of Death Receptors and Ligands

TNFRSF10C (TNF receptor superfamily member 10c)