Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8794
Gene name Gene Name - the full gene name approved by the HGNC.	TNF receptor superfamily member 10c
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFRSF10C
Synonyms (NCBI Gene) Gene synonyms aliases	CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and

Show/Hide all(77)

miRTarBase ID	miRNA	Experiments
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT1442774	hsa-miR-1292	CLIP-seq
MIRT1442775	hsa-miR-1321	CLIP-seq
MIRT1442776	hsa-miR-1827	CLIP-seq
MIRT1442777	hsa-miR-1909	CLIP-seq
MIRT1442778	hsa-miR-2467-3p	CLIP-seq
MIRT1442779	hsa-miR-3126-5p	CLIP-seq
MIRT1442780	hsa-miR-3199	CLIP-seq
MIRT1442781	hsa-miR-3612	CLIP-seq
MIRT1442782	hsa-miR-361-3p	CLIP-seq
MIRT1442783	hsa-miR-4260	CLIP-seq
MIRT1442784	hsa-miR-4267	CLIP-seq
MIRT1442785	hsa-miR-4419a	CLIP-seq
MIRT1442786	hsa-miR-4436b-3p	CLIP-seq
MIRT1442787	hsa-miR-4471	CLIP-seq
MIRT1442788	hsa-miR-4510	CLIP-seq
MIRT1442789	hsa-miR-4648	CLIP-seq
MIRT1442790	hsa-miR-4654	CLIP-seq
MIRT1442791	hsa-miR-4688	CLIP-seq
MIRT1442792	hsa-miR-4733-3p	CLIP-seq
MIRT1442793	hsa-miR-4739	CLIP-seq
MIRT1442794	hsa-miR-4740-5p	CLIP-seq
MIRT1442795	hsa-miR-4756-5p	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442797	hsa-miR-4768-3p	CLIP-seq
MIRT1442798	hsa-miR-4769-5p	CLIP-seq
MIRT1442799	hsa-miR-486-3p	CLIP-seq
MIRT1442800	hsa-miR-650	CLIP-seq
MIRT1442801	hsa-miR-665	CLIP-seq
MIRT1442802	hsa-miR-922	CLIP-seq
MIRT1442803	hsa-miR-940	CLIP-seq
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT1442774	hsa-miR-1292	CLIP-seq
MIRT2132513	hsa-miR-3120-5p	CLIP-seq
MIRT1442787	hsa-miR-4471	CLIP-seq
MIRT1442789	hsa-miR-4648	CLIP-seq
MIRT1442790	hsa-miR-4654	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442798	hsa-miR-4769-5p	CLIP-seq
MIRT1442773	hsa-miR-1207-5p	CLIP-seq
MIRT2693662	hsa-miR-1254	CLIP-seq
MIRT2693663	hsa-miR-1291	CLIP-seq
MIRT1442775	hsa-miR-1321	CLIP-seq
MIRT1442776	hsa-miR-1827	CLIP-seq
MIRT2693664	hsa-miR-193a-3p	CLIP-seq
MIRT2693665	hsa-miR-193b	CLIP-seq
MIRT1442778	hsa-miR-2467-3p	CLIP-seq
MIRT2693666	hsa-miR-2861	CLIP-seq
MIRT2693667	hsa-miR-3064-5p	CLIP-seq
MIRT2693668	hsa-miR-3116	CLIP-seq
MIRT2693669	hsa-miR-3173-5p	CLIP-seq
MIRT2693670	hsa-miR-328	CLIP-seq
MIRT1442781	hsa-miR-3612	CLIP-seq
MIRT2693671	hsa-miR-3652	CLIP-seq
MIRT2693672	hsa-miR-3689a-3p	CLIP-seq
MIRT2693673	hsa-miR-3689c	CLIP-seq
MIRT2693674	hsa-miR-3928	CLIP-seq
MIRT2693675	hsa-miR-4290	CLIP-seq
MIRT2693676	hsa-miR-4313	CLIP-seq
MIRT2693677	hsa-miR-432	CLIP-seq
MIRT1442785	hsa-miR-4419a	CLIP-seq
MIRT2693678	hsa-miR-4426	CLIP-seq
MIRT2693679	hsa-miR-4430	CLIP-seq
MIRT1442786	hsa-miR-4436b-3p	CLIP-seq
MIRT2693680	hsa-miR-4505	CLIP-seq
MIRT1442788	hsa-miR-4510	CLIP-seq
MIRT2693681	hsa-miR-4647	CLIP-seq
MIRT2693682	hsa-miR-4662b	CLIP-seq
MIRT2693683	hsa-miR-4699-5p	CLIP-seq
MIRT2693684	hsa-miR-4728-5p	CLIP-seq
MIRT1442793	hsa-miR-4739	CLIP-seq
MIRT1442795	hsa-miR-4756-5p	CLIP-seq
MIRT1442796	hsa-miR-4763-3p	CLIP-seq
MIRT1442800	hsa-miR-650	CLIP-seq
MIRT2693685	hsa-miR-661	CLIP-seq
MIRT1442802	hsa-miR-922	CLIP-seq
MIRT1442803	hsa-miR-940	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9314565
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS	9314565
GO:0009986	Component	Cell surface	IBA	21873635
GO:0031225	Component	Anchored component of membrane	IEA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IBA	21873635
GO:0042981	Process	Regulation of apoptotic process	TAS
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0045569	Function	TRAIL binding	IEA

MIM	HGNC	e!Ensembl
603613	11906	ENSG00000173535

Protein

UniProt ID

O14798

Protein name

Tumor necrosis factor receptor superfamily member 10C (Antagonist decoy receptor for TRAIL/Apo-2L) (Decoy TRAIL receptor without death domain) (Decoy receptor 1) (DcR1) (Lymphocyte inhibitor of TRAIL) (TNF-related apoptosis-inducing ligand receptor 3) (TR

Protein function

Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	69 → 109	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	111 → 149	TNFR/NGFR cysteine-rich region	Domain

Tissue specificity

TISSUE SPECIFICITY: Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Sequence

MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHY
LSCTIVGIIVLIVLLIVFV

Sequence length

259

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor		TP53 Regulates Transcription of Death Receptors and Ligands

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	19435948
Arthritis Rheumatoid	Associate	14613271, 20799941
Breast Neoplasms	Associate	14623878, 21092294, 24218337, 28420351
Carcinoma Endometrioid	Associate	23584885
Carcinoma Hepatocellular	Associate	20676325
Carcinoma Ovarian Epithelial	Associate	17569106
Chronic Periodontitis	Associate	25056994
Colitis Ulcerative	Associate	16856205
Colonic Neoplasms	Associate	36646765
Colorectal Neoplasms	Associate	18590575, 18755584, 33779485, 34541005
Crohn Disease	Associate	18942021
Diabetes Mellitus Type 1	Stimulate	18057577
Endometrial Hyperplasia	Associate	23584885, 24649804
Endometrial Neoplasms	Associate	24649804
Epileptic Syndromes	Inhibit	22891927
Hippocampal Sclerosis	Associate	28189700
IgA Vasculitis	Associate	15270863
Inflammation	Associate	32482836
Leukemia	Associate	21281967
Leukemia Myeloid Acute	Associate	21281967
Melanoma	Associate	24762620
Multiple Myeloma	Associate	11495702
Neoplasm Metastasis	Associate	18590575
Neoplasm Metastasis	Stimulate	28420351
Neoplasms	Associate	10933923, 11350953, 18460741, 19035483, 22258036, 28420351, 34127544
Neoplasms	Inhibit	22629410
Osteosarcoma	Associate	40165145
Ovarian Neoplasms	Associate	32629664
Pancreatic Neoplasms	Associate	22629410
Pancreatitis Chronic	Associate	12808117
Placenta Accreta	Stimulate	31322233
Prostatic Neoplasms	Inhibit	18460741
Prostatic Neoplasms	Associate	19035483
Prostatitis	Associate	18460741, 19035483
Refsum Disease Infantile	Associate	29844446
Squamous Cell Carcinoma of Head and Neck	Associate	17592646
Uterine Cervical Neoplasms	Associate	17894941

TNFRSF10C (TNF receptor superfamily member 10c)