Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8792
Gene name	TNF receptor superfamily member 11a
Gene symbol	TNFRSF11A
Synonyms (NCBI Gene)	CD265FEOLOH18CR1ODFROFEOPTB7OSTSPDB2RANKTRANCE-RTRANCER
Chromosome	18
Chromosome location	18q21.33
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are i

Show/Hide all (14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34966542	T>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, intron variant, synonymous variant
rs121908655	A>G	Pathogenic	Missense variant, coding sequence variant
rs121908656	T>C	Pathogenic	Missense variant, coding sequence variant
rs121908657	C>T	Uncertain-significance, pathogenic	Missense variant, synonymous variant, coding sequence variant
rs121908658	G>T	Pathogenic	Missense variant, intron variant, stop gained, coding sequence variant
rs121908659	G>A,C	Pathogenic	Missense variant, synonymous variant, coding sequence variant, 5 prime UTR variant
rs547088539	G>A	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, synonymous variant
rs772863037	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, synonymous variant, coding sequence variant
rs776173779	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, intron variant, coding sequence variant
rs796051862	->GCTGCTGCTGCTCTGCGCGCTGCTCGC	Pathogenic	Genic upstream transcript variant, inframe insertion, 5 prime UTR variant, coding sequence variant
rs879253796	->CTGCTCTGCGCGCTGCTC	Pathogenic	Coding sequence variant, genic upstream transcript variant, inframe insertion, 5 prime UTR variant
rs886037749	->GCTGCTCTGCGCGCTGCT	Pathogenic	Coding sequence variant, genic upstream transcript variant, inframe insertion, 5 prime UTR variant
rs1555767678	->CTCTGCGCGCTGCTC	Pathogenic	Inframe insertion, 5 prime UTR variant, genic upstream transcript variant, coding sequence variant
rs1600406856	GCA>CC	Likely-pathogenic	Coding sequence variant, frameshift variant, intron variant

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029973	hsa-miR-26b-5p	Microarray	19088304
MIRT054780	hsa-miR-503-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23821519
MIRT553480	hsa-miR-3150a-5p	PAR-CLIP	21572407
MIRT553479	hsa-miR-3150b-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT553478	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT553480	hsa-miR-3150a-5p	PAR-CLIP	21572407
MIRT553479	hsa-miR-3150b-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT553478	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT1442842	hsa-miR-1251	CLIP-seq
MIRT1442843	hsa-miR-1273e	CLIP-seq
MIRT1442844	hsa-miR-136	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT1442846	hsa-miR-3180-5p	CLIP-seq
MIRT1442847	hsa-miR-3614-5p	CLIP-seq
MIRT1442848	hsa-miR-3672	CLIP-seq
MIRT1442849	hsa-miR-3675-5p	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT1442853	hsa-miR-4293	CLIP-seq
MIRT1442854	hsa-miR-4505	CLIP-seq
MIRT1442855	hsa-miR-4640-5p	CLIP-seq
MIRT1442856	hsa-miR-4668-5p	CLIP-seq
MIRT1442857	hsa-miR-4671-5p	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442859	hsa-miR-4726-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442861	hsa-miR-4786-5p	CLIP-seq
MIRT1442862	hsa-miR-4793-3p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442864	hsa-miR-515-5p	CLIP-seq
MIRT1442865	hsa-miR-520a-5p	CLIP-seq
MIRT1442866	hsa-miR-525-5p	CLIP-seq
MIRT1442867	hsa-miR-541	CLIP-seq
MIRT1442868	hsa-miR-555	CLIP-seq
MIRT1442869	hsa-miR-570	CLIP-seq
MIRT1442870	hsa-miR-596	CLIP-seq
MIRT1442871	hsa-miR-625	CLIP-seq
MIRT1442872	hsa-miR-654-5p	CLIP-seq
MIRT1442873	hsa-miR-661	CLIP-seq
MIRT1442874	hsa-miR-769-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq
MIRT1442876	hsa-miR-890	CLIP-seq
MIRT1442844	hsa-miR-136	CLIP-seq
MIRT2132528	hsa-miR-3150b-3p	CLIP-seq
MIRT2132529	hsa-miR-3175	CLIP-seq
MIRT2132530	hsa-miR-3198	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT2132531	hsa-miR-4309	CLIP-seq
MIRT2132532	hsa-miR-432	CLIP-seq
MIRT2132533	hsa-miR-4653-3p	CLIP-seq
MIRT2132534	hsa-miR-4689	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT2132535	hsa-miR-4784	CLIP-seq
MIRT1442864	hsa-miR-515-5p	CLIP-seq
MIRT1442876	hsa-miR-890	CLIP-seq
MIRT2132536	hsa-miR-891b	CLIP-seq
MIRT1442844	hsa-miR-136	CLIP-seq
MIRT1442846	hsa-miR-3180-5p	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT2353503	hsa-miR-3942-3p	CLIP-seq
MIRT2353504	hsa-miR-4517	CLIP-seq
MIRT1442857	hsa-miR-4671-5p	CLIP-seq
MIRT2353505	hsa-miR-4719	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442864	hsa-miR-515-5p	CLIP-seq
MIRT1442865	hsa-miR-520a-5p	CLIP-seq
MIRT1442866	hsa-miR-525-5p	CLIP-seq
MIRT1442874	hsa-miR-769-5p	CLIP-seq
MIRT2396114	hsa-miR-1184	CLIP-seq
MIRT1442876	hsa-miR-890	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT2462057	hsa-miR-3652	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT2462058	hsa-miR-4430	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT2647683	hsa-miR-3135b	CLIP-seq
MIRT2462057	hsa-miR-3652	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT2462058	hsa-miR-4430	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT2647683	hsa-miR-3135b	CLIP-seq
MIRT2462057	hsa-miR-3652	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT2462058	hsa-miR-4430	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SPI1	Unknown	16083856

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IBA
GO:0001503	Process	Ossification	IEA
GO:0002250	Process	Adaptive immune response	IMP	18606301
GO:0002376	Process	Immune system process	IEA
GO:0002548	Process	Monocyte chemotaxis	NAS	15248232
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	9367155
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005031	Function	Tumor necrosis factor receptor activity	IBA
GO:0005031	Function	Tumor necrosis factor receptor activity	IEA
GO:0005031	Function	Tumor necrosis factor receptor activity	ISS	19940926
GO:0005515	Function	Protein binding	IPI	10075662, 15750601, 23333834, 29844572
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	9367155
GO:0007267	Process	Cell-cell signaling	TAS	9367155
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	9367155
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	9367155
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019955	Function	Cytokine binding	IBA
GO:0019955	Function	Cytokine binding	IPI	9367155
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	IMP	18606301
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS	19940926
GO:0032868	Process	Response to insulin	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IBA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	12296995
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	18606301
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	ISS	19940926
GO:0034224	Process	Cellular response to zinc ion starvation	IEA
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0034612	Process	Response to tumor necrosis factor	ISS	19940926
GO:0038023	Function	Signaling receptor activity	TAS	9367155
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	12296995
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045471	Process	Response to ethanol	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045672	Process	Positive regulation of osteoclast differentiation	ISS
GO:0045780	Process	Positive regulation of bone resorption	IBA
GO:0045780	Process	Positive regulation of bone resorption	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	12296995
GO:0046872	Function	Metal ion binding	IEA
GO:0048535	Process	Lymph node development	IBA
GO:0048535	Process	Lymph node development	IEA
GO:0060086	Process	Circadian temperature homeostasis	IEA
GO:0060086	Process	Circadian temperature homeostasis	ISS	19940926
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	18606301
GO:0070555	Process	Response to interleukin-1	IEA
GO:0070555	Process	Response to interleukin-1	ISS	19940926
GO:0071812	Process	Positive regulation of fever generation by positive regulation of prostaglandin secretion	IEA
GO:0071812	Process	Positive regulation of fever generation by positive regulation of prostaglandin secretion	ISS	19940926
GO:0072674	Process	Multinuclear osteoclast differentiation	IBA
GO:0072674	Process	Multinuclear osteoclast differentiation	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	9367155

MIM	HGNC	e!Ensembl
603499	11908	ENSG00000141655

Q9Y6Q6

Protein name

Tumor necrosis factor receptor superfamily member 11A (Osteoclast differentiation factor receptor) (ODFR) (Receptor activator of NF-KB) (CD antigen CD265)

Protein function

Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis (PubMed:9878548). Its interaction with EEIG1 promotes osteoclastogenesis via facilitating the transcription of NFATC1 and activation of PLCG2 (By similarity)

PDB

1LB5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18278	RANK_CRD_2	89 → 129	Receptor activator of the NF-KB cysteine-rich repeat domain 2	Domain
PF00020	TNFR_c6	154 → 194	TNFR/NGFR cysteine-rich region	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.

Sequence

MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKC
TTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHW
SQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGK
RVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGK
ALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMC
YPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQL
LFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSEN
YLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPP
EEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVM
NFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLRE
PEKASRPVQEQGGAKA

Sequence length

616

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction NF-kappa B signaling pathway Osteoclast differentiation Prolactin signaling pathway Rheumatoid arthritis		TNFR2 non-canonical NF-kB pathway TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

298

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal recessive osteopetrosis 7	Likely pathogenic; Pathogenic	rs2145289462, rs2145309285, rs2145357936, rs121908655, rs121908656, rs121908658, rs121908659, rs2145223302, rs2145308907, rs2046440702, rs2511566983	RCV002247761 RCV002247762 RCV002247763 RCV000006681 RCV000006682 RCV000006684 RCV000006685 RCV003152983 RCV003225712 RCV003318520 RCV003313733
Familial expansile osteolysis	Pathogenic; Likely pathogenic	rs886037749, rs879253796	RCV000190351 RCV000006679
Paget disease of bone 2, early-onset	Pathogenic	rs886037749, rs1555767678, rs796051862	RCV000660386 RCV000190352 RCV000006680

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Bone Paget disease	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs146553439, rs1805033, rs7238731, rs1805034, rs8092336, rs148185533, rs886054081, rs886054088, rs886054099, rs150401931, rs552069161, rs142942284, rs35211496, rs61751992, rs886054089, rs886054093, rs78622775 View all (2 more)	RCV000372728 RCV000276795 RCV000370833 RCV000338163 RCV000344991 RCV000350950 RCV000356202 RCV000297001 RCV000357519 RCV000259433 RCV000348145 RCV000291400 RCV000269060 RCV000261260 RCV000342238 RCV000354253 RCV000326341 RCV000342996
Disorder of bone	Benign; Likely benign; Uncertain significance	rs1805034, rs117028614, rs35211496	RCV006268698 RCV006268738 RCV006268737
Familial cancer of breast	Conflicting classifications of pathogenicity	rs201402594	RCV005904495
Lung cancer	Uncertain significance	rs761595131	RCV005932027
Malignant tumor of esophagus	Uncertain significance	rs747510807	RCV005926474
Osteopetrosis	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs146553439, rs1805033, rs7238731, rs1805034, rs8092336, rs148185533, rs886054081, rs886054088, rs886054099, rs150401931, rs552069161, rs142942284, rs35211496, rs61751992, rs886054089, rs886054093, rs78622775 View all (2 more)	RCV000278264 RCV000327121 RCV000312036 RCV000280881 RCV000306408 RCV000390248 RCV000275612 RCV000398720 RCV000265374 RCV000317703 RCV000400681 RCV000320710 RCV000363657 RCV000318919 RCV000284808 RCV000408052 RCV000383381 RCV000400883
Thyroid cancer, nonmedullary, 1	Conflicting classifications of pathogenicity	rs201402594	RCV005904496
TNFRSF11A-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity; Benign	rs1302537567, rs369489962, rs139968917, rs200750073, rs753971282, rs182849554, rs771249524, rs148185533, rs34966542, rs1463920572, rs776173779, rs367884859, rs763654840, rs375618864, rs1600407119 View all (5 more)	RCV003913485 RCV004731196 RCV003948815 RCV003948858 RCV003933519 RCV004753533 RCV003955101 RCV003940032 RCV003967769 RCV003402294 RCV003414189 RCV003948997 RCV003893546 RCV003982603 RCV003911767 RCV003954633 RCV003409519 RCV003912369 RCV003947918 RCV003905852

Show/Hide Text Mining Associations (105)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acro Osteolysis	Associate	36740137
Adenocarcinoma	Associate	34724890
Adenocarcinoma of Lung	Associate	35437508, 37543671
Adenocarcinoma of Lung	Stimulate	39273449
Agammaglobulinemia	Associate	18606301, 22271396
Ameloblastoma	Associate	21643971
Amyotrophic Lateral Sclerosis	Associate	21659498
Aortic Valve Calcification of	Associate	28246602
Aortic Valve Stenosis	Associate	28246602
Aphasia Broca	Associate	36818472
Arthritis Psoriatic	Stimulate	28619088
Arthritis Rheumatoid	Associate	18839399, 27054952, 27572279, 32815001
Atrial Fibrillation	Associate	22001292
Atrial Remodeling	Associate	22001292
Bone Diseases	Associate	25063546, 26617755, 26781475, 40222603
Bone Diseases Metabolic	Associate	22370887
Bone Neoplasms	Associate	17982618
Bone Resorption	Associate	16936272, 16960694
Breast Neoplasms	Associate	21559440, 22824341, 26781475, 27191503, 27893411, 28577080, 28758931, 29932437, 35697931
Calcinosis	Associate	16449517
Calcinosis Cutis	Stimulate	21407234
Carcinogenesis	Associate	34570303
Carcinoma Giant Cell	Associate	35697931
Carcinoma Ovarian Epithelial	Associate	35163671
Carcinoma Renal Cell	Associate	26528707
Cardiomegaly	Associate	12929927
Cardiovascular Diseases	Associate	22001292
Cataract	Associate	32180680
Cognition Disorders	Associate	35858838
Colonic Neoplasms	Associate	33985413, 36646765
Colorectal Neoplasms	Associate	34541005
COVID 19	Associate	36818472
Cysts	Associate	21683340
Delayed Emergence from Anesthesia	Associate	24081232
Dentigerous Cyst	Associate	21683340
Diabetes Mellitus	Associate	21659498
Disease	Associate	11771666, 31923705
Dysosteosclerosis	Associate	31163101
Edema	Associate	12568416
Endometrial Neoplasms	Associate	29932437
Esophageal Neoplasms	Associate	25019155, 25973136
Esophageal Squamous Cell Carcinoma	Associate	25019155, 25973136
Expansile Bone Lesions	Associate	31923705, 36740137
Familial Paget's disease of bone	Associate	36740137
Femur Head Necrosis	Associate	26617755
Fibrous Dysplasia Polyostotic	Associate	21987421
Frailty	Associate	37254268
Giant Cell Tumor of Tendon Sheath	Associate	31189751
Glioma	Associate	22787434
Hearing Loss	Associate	12568416, 12929927, 31923705, 40222603
Heart Failure Diastolic	Associate	34685778
Heart Valve Diseases	Associate	16449517, 27003233
Hip Injuries	Inhibit	21760914
Hip Injuries	Associate	21760914
Hodgkin Disease	Associate	11675352
Hypercalcemia	Associate	11781248, 12929927, 22271396, 31923705, 40222603
Hyperostosis corticalis deformans juvenilis	Associate	11771666, 12929927, 20564239, 21987421, 25063546, 31923705, 32298837
Immunologic Deficiency Syndromes	Associate	18606301
Inflammation	Associate	27003233, 34685778
Iron Overload	Associate	37532711
Kidney Diseases	Associate	25478860
Kidney Neoplasms	Associate	37407978
Leukemia Lymphoma Adult T Cell	Associate	11781248
Liver Cirrhosis Biliary	Associate	27054952
Lymphatic Metastasis	Stimulate	25973136
Lymphoma Large B Cell Diffuse	Associate	19412164
Melanoma	Associate	21407234
Monckeberg Medial Calcific Sclerosis	Associate	21659498
Multiple Myeloma	Associate	26762414, 36251145
Musculoskeletal Diseases	Associate	12929927
Myalgia	Associate	28619088
Myasthenia Gravis	Associate	25643325, 35074870
Neoplasm Metastasis	Associate	21559440, 26528707, 27191503, 28577080
Neoplasms	Associate	21559440, 23369128, 31992773, 35163671, 39273449
Neoplasms	Stimulate	26781475
Obesity	Associate	16960694
Oculocerebrorenal Syndrome	Associate	31923705
Odontogenic Cysts	Associate	21643971, 33768738
Osteitis Deformans	Associate	11149487, 11473345, 11742440, 12929927, 19578385, 19925894, 20436471, 20564239, 21623375, 21987421, 31923705
Osteoarthritis Knee	Associate	30921190
Osteolysis	Associate	21643971, 21659498, 33768738
Osteonecrosis	Associate	25820558, 26617755
Osteopetrosis	Associate	18606301, 20564239, 22271396, 24108692, 32097281, 34049530
Osteopetrosis Autosomal Recessive 1	Associate	19507210
Osteopetrosis Autosomal Recessive 7	Associate	31163101
Osteopetrosis mild autosomal recessive form	Associate	18606301, 22271396, 28816234
Osteoporosis	Associate	22370887, 34049530
Osteoporotic Fractures	Associate	22370887
Osteosarcoma	Associate	17982618, 38468522
Pain	Associate	12568416
Polyostotic osteolytic dysplasia hereditary expansile	Associate	11555792, 11742440, 11771666, 12568416, 12929927, 20564239, 31923705, 36740137
Radicular Cyst	Associate	21643971
Root Resorption	Associate	40222603
Stomach Neoplasms	Associate	30015970, 35421138
Tachycardia Sinoatrial Nodal Reentry	Stimulate	34737220
Tendinopathy	Associate	40222603
Tibial Neuropathy	Associate	12568416
Tooth Loss	Associate	12929927, 31923705
Transfusion Reaction	Associate	35858838, 37532711
Uterine Cervical Dysplasia	Stimulate	25973136
Uterine Cervical Neoplasms	Associate	32616510
Vascular Calcification	Associate	21659498
Weight Loss	Associate	24081232
Wiskott Aldrich Syndrome	Associate	32097281
Zellweger Syndrome	Associate	21987421

TNFRSF11A (TNF receptor superfamily member 11a)