Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8792
Gene name Gene Name - the full gene name approved by the HGNC.	TNF receptor superfamily member 11a
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFRSF11A
Synonyms (NCBI Gene) Gene synonyms aliases	CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCE-R, TRANCER
Disease Acronyms (UniProt) Disease acronyms from UniProt database	FEO, OPTB7, PDB2
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q21.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are i

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34966542	T>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, intron variant, synonymous variant
rs121908655	A>G	Pathogenic	Missense variant, coding sequence variant
rs121908656	T>C	Pathogenic	Missense variant, coding sequence variant
rs121908657	C>T	Uncertain-significance, pathogenic	Missense variant, synonymous variant, coding sequence variant
rs121908658	G>T	Pathogenic	Missense variant, intron variant, stop gained, coding sequence variant
rs121908659	G>A,C	Pathogenic	Missense variant, synonymous variant, coding sequence variant, 5 prime UTR variant
rs547088539	G>A	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, synonymous variant
rs772863037	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, synonymous variant, coding sequence variant
rs776173779	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, intron variant, coding sequence variant
rs796051862	->GCTGCTGCTGCTCTGCGCGCTGCTCGC	Pathogenic	Genic upstream transcript variant, inframe insertion, 5 prime UTR variant, coding sequence variant
rs879253796	->CTGCTCTGCGCGCTGCTC	Pathogenic	Coding sequence variant, genic upstream transcript variant, inframe insertion, 5 prime UTR variant
rs886037749	->GCTGCTCTGCGCGCTGCT	Pathogenic	Coding sequence variant, genic upstream transcript variant, inframe insertion, 5 prime UTR variant
rs1555767678	->CTCTGCGCGCTGCTC	Pathogenic	Inframe insertion, 5 prime UTR variant, genic upstream transcript variant, coding sequence variant
rs1600406856	GCA>CC	Likely-pathogenic	Coding sequence variant, frameshift variant, intron variant

Show/Hide all(153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029973	hsa-miR-26b-5p	Microarray	19088304
MIRT054780	hsa-miR-503-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23821519
MIRT553480	hsa-miR-3150a-5p	PAR-CLIP	21572407
MIRT553479	hsa-miR-3150b-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT553478	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT553480	hsa-miR-3150a-5p	PAR-CLIP	21572407
MIRT553479	hsa-miR-3150b-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT553478	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT543104	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT543103	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT543102	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT543101	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT543100	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT543099	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT543098	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT543097	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT543096	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT543094	hsa-miR-4775	PAR-CLIP	21572407
MIRT543095	hsa-miR-548aw	PAR-CLIP	21572407
MIRT543093	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT1442842	hsa-miR-1251	CLIP-seq
MIRT1442843	hsa-miR-1273e	CLIP-seq
MIRT1442844	hsa-miR-136	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT1442846	hsa-miR-3180-5p	CLIP-seq
MIRT1442847	hsa-miR-3614-5p	CLIP-seq
MIRT1442848	hsa-miR-3672	CLIP-seq
MIRT1442849	hsa-miR-3675-5p	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT1442853	hsa-miR-4293	CLIP-seq
MIRT1442854	hsa-miR-4505	CLIP-seq
MIRT1442855	hsa-miR-4640-5p	CLIP-seq
MIRT1442856	hsa-miR-4668-5p	CLIP-seq
MIRT1442857	hsa-miR-4671-5p	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442859	hsa-miR-4726-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442861	hsa-miR-4786-5p	CLIP-seq
MIRT1442862	hsa-miR-4793-3p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442864	hsa-miR-515-5p	CLIP-seq
MIRT1442865	hsa-miR-520a-5p	CLIP-seq
MIRT1442866	hsa-miR-525-5p	CLIP-seq
MIRT1442867	hsa-miR-541	CLIP-seq
MIRT1442868	hsa-miR-555	CLIP-seq
MIRT1442869	hsa-miR-570	CLIP-seq
MIRT1442870	hsa-miR-596	CLIP-seq
MIRT1442871	hsa-miR-625	CLIP-seq
MIRT1442872	hsa-miR-654-5p	CLIP-seq
MIRT1442873	hsa-miR-661	CLIP-seq
MIRT1442874	hsa-miR-769-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq
MIRT1442876	hsa-miR-890	CLIP-seq
MIRT1442844	hsa-miR-136	CLIP-seq
MIRT2132528	hsa-miR-3150b-3p	CLIP-seq
MIRT2132529	hsa-miR-3175	CLIP-seq
MIRT2132530	hsa-miR-3198	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT2132531	hsa-miR-4309	CLIP-seq
MIRT2132532	hsa-miR-432	CLIP-seq
MIRT2132533	hsa-miR-4653-3p	CLIP-seq
MIRT2132534	hsa-miR-4689	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT2132535	hsa-miR-4784	CLIP-seq
MIRT1442864	hsa-miR-515-5p	CLIP-seq
MIRT1442876	hsa-miR-890	CLIP-seq
MIRT2132536	hsa-miR-891b	CLIP-seq
MIRT1442844	hsa-miR-136	CLIP-seq
MIRT1442846	hsa-miR-3180-5p	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT2353503	hsa-miR-3942-3p	CLIP-seq
MIRT2353504	hsa-miR-4517	CLIP-seq
MIRT1442857	hsa-miR-4671-5p	CLIP-seq
MIRT2353505	hsa-miR-4719	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442864	hsa-miR-515-5p	CLIP-seq
MIRT1442865	hsa-miR-520a-5p	CLIP-seq
MIRT1442866	hsa-miR-525-5p	CLIP-seq
MIRT1442874	hsa-miR-769-5p	CLIP-seq
MIRT2396114	hsa-miR-1184	CLIP-seq
MIRT1442876	hsa-miR-890	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT2462057	hsa-miR-3652	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT2462058	hsa-miR-4430	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT2647683	hsa-miR-3135b	CLIP-seq
MIRT2462057	hsa-miR-3652	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT2462058	hsa-miR-4430	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq
MIRT1442845	hsa-miR-3122	CLIP-seq
MIRT2647683	hsa-miR-3135b	CLIP-seq
MIRT2462057	hsa-miR-3652	CLIP-seq
MIRT1442850	hsa-miR-3689a-3p	CLIP-seq
MIRT1442851	hsa-miR-3689c	CLIP-seq
MIRT1442852	hsa-miR-3913-5p	CLIP-seq
MIRT2462058	hsa-miR-4430	CLIP-seq
MIRT1442858	hsa-miR-4712-5p	CLIP-seq
MIRT1442860	hsa-miR-4728-5p	CLIP-seq
MIRT1442863	hsa-miR-485-5p	CLIP-seq
MIRT1442875	hsa-miR-770-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SPI1	Unknown	16083856

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IBA	21873635
GO:0002250	Process	Adaptive immune response	IMP	18606301
GO:0002548	Process	Monocyte chemotaxis	NAS	15248232
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	9367155
GO:0005031	Function	Tumor necrosis factor-activated receptor activity	IBA	21873635
GO:0005031	Function	Tumor necrosis factor-activated receptor activity	ISS	19940926
GO:0005515	Function	Protein binding	IPI	10075662, 15750601, 23333834, 29844572
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	9367155
GO:0007267	Process	Cell-cell signaling	TAS	9367155
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	9367155
GO:0009314	Process	Response to radiation	IEA
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	9367155
GO:0016021	Component	Integral component of membrane	IEA
GO:0019955	Function	Cytokine binding	IBA	21873635
GO:0019955	Function	Cytokine binding	IPI	9367155
GO:0030316	Process	Osteoclast differentiation	IMP	18606301
GO:0032496	Process	Response to lipopolysaccharide	ISS	19940926
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	ISS	19940926
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034097	Process	Response to cytokine	IMP	18606301
GO:0034612	Process	Response to tumor necrosis factor	ISS	19940926
GO:0038023	Function	Signaling receptor activity	TAS	9367155
GO:0043507	Process	Positive regulation of JUN kinase activity	IMP	12296995
GO:0045780	Process	Positive regulation of bone resorption	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:0048535	Process	Lymph node development	IBA	21873635
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	12296995
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	ISS	19940926
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	9367155
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	12296995
GO:0060086	Process	Circadian temperature homeostasis	ISS	19940926
GO:0060749	Process	Mammary gland alveolus development	IBA	21873635
GO:0070555	Process	Response to interleukin-1	IBA	21873635
GO:0070555	Process	Response to interleukin-1	ISS	19940926
GO:0071812	Process	Positive regulation of fever generation by positive regulation of prostaglandin secretion	ISS	19940926
GO:0071847	Process	TNFSF11-mediated signaling pathway	IBA	21873635
GO:0071847	Process	TNFSF11-mediated signaling pathway	IMP	18606301
GO:0071848	Process	Positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling	IMP	18606301
GO:0072674	Process	Multinuclear osteoclast differentiation	IBA	21873635

MIM	HGNC	e!Ensembl
603499	11908	ENSG00000141655

Protein

UniProt ID

Q9Y6Q6

Protein name

Tumor necrosis factor receptor superfamily member 11A (Osteoclast differentiation factor receptor) (ODFR) (Receptor activator of NF-KB) (CD antigen CD265)

Protein function

Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis (PubMed:9878548). Its interaction with EEIG1 promotes osteoclastogenesis via facilitating the transcription of NFATC1 and activation of PLCG2 (By similarity)

PDB

1LB5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18278	RANK_CRD_2	89 → 129	Receptor activator of the NF-KB cysteine-rich repeat domain 2	Domain
PF00020	TNFR_c6	154 → 194	TNFR/NGFR cysteine-rich region	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.

Sequence

MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKC
TTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHW
SQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGK
RVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGLIILLLFASVALVAAIIFGVCYRKKGK
ALTANLWHWINEACGRLSGDKESSGDSCVSTHTANFGQQGACEGVLLLTLEEKTFPEDMC
YPDQGGVCQGTCVGGGPYAQGEDARMLSLVSKTEIEEDSFRQMPTEDEYMDRPSQPTDQL
LFLTEPGSKSTPPFSEPLEVGENDSLSQCFTGTQSTVGSESCNCTEPLCRTDWTPMSSEN
YLQKEVDSGHCPHWAASPSPNWADVCTGCRNPPGEDCEPLVGSPKRGPLPQCAYGMGLPP
EEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVM
NFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLRE
PEKASRPVQEQGGAKA

Sequence length

616

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction NF-kappa B signaling pathway Osteoclast differentiation Prolactin signaling pathway Rheumatoid arthritis		TNFR2 non-canonical NF-kB pathway TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

Show/Hide Causal Diseases (14)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Expansile osteolysis	Familial expansile osteolysis	rs879253796, rs886037749	10615125
Hearing loss	Conductive hearing loss	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Hydrocephalus	Hydrocephalus	rs387907320, rs369384363, rs387907321, rs372127610, rs770273135, rs797045095, rs797045707, rs769795916, rs781251438, rs922703465, rs376078512, rs1567043467, rs1587149916, rs1586841546
Hyperphosphatasemia with bone disease	Hyperphosphatasemia with bone disease	rs796051868, rs104894091, rs2129878039, rs200071478, rs1307942060	25063546
Hypertension	Hypertensive disease	rs13306026
Macrocephaly	Macrocephaly	rs786204854, rs764333096, rs1557739557
Myasthenia gravis	Myasthenia Gravis, Adult-onset myasthenia gravis	rs5030818, rs121912815, rs121912817, rs121912818, rs121912821, rs75466054, rs121912822, rs121912823, rs794727516, rs764497513, rs376808313, rs1279554995, rs1554802792, rs369251527, rs372760913 View all (8 more)	26562150, 25643325
Nystagmus	Nystagmus	rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Optic atrophy	Optic Atrophy	rs121434508, rs267607017, rs80356524, rs80356525, rs879255560, rs104893753, rs80356529, rs397515360, rs104893620, rs199476104, rs199476112, rs199476118, rs398124298, rs770066665, rs398124299 View all (37 more)
Osteopetrosis	Osteopetrosis, Osteopetrosis, Autosomal Recessive 7	rs786205055, rs1562370077, rs119460973, rs1554996130, rs137853149, rs751881962, rs137853150, rs137853151, rs2134438856, rs121908669, rs121908670, rs121908671, rs121908673, rs121908655, rs121908656 View all (73 more)	18606301
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287
Paget disease	Osteitis Deformans, PAGET DISEASE OF BONE 2, EARLY-ONSET, Juvenile Paget disease, NON RARE IN EUROPE: Paget disease of bone	rs796051862, rs796051869, rs796051870, rs796052213, rs1555767678, rs869025582	11351498, 12673693, 20436471

Show/Hide Unknown Diseases (8)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Childhood asthma	31036433, 30929738	ClinVar, GWAS
Vitiligo	Vitiligo		GWAS
Eczema	Eczema		GWAS
Myasthenia Gravis	Myasthenia Gravis		GWAS
Dermatitis	Dermatitis		GWAS
Osteoarthritis Of Hip	Osteoarthritis Of Hip		GWAS
Rheumatoid arthritis	Rheumatoid arthritis		GWAS
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (105)

Disease Name	Relationship Type	References
Associations from Text Mining
Acro Osteolysis	Associate	36740137
Adenocarcinoma	Associate	34724890
Adenocarcinoma of Lung	Associate	35437508, 37543671
Adenocarcinoma of Lung	Stimulate	39273449
Agammaglobulinemia	Associate	18606301, 22271396
Ameloblastoma	Associate	21643971
Amyotrophic Lateral Sclerosis	Associate	21659498
Aortic Valve Calcification of	Associate	28246602
Aortic Valve Stenosis	Associate	28246602
Aphasia Broca	Associate	36818472
Arthritis Psoriatic	Stimulate	28619088
Arthritis Rheumatoid	Associate	18839399, 27054952, 27572279, 32815001
Atrial Fibrillation	Associate	22001292
Atrial Remodeling	Associate	22001292
Bone Diseases	Associate	25063546, 26617755, 26781475, 40222603
Bone Diseases Metabolic	Associate	22370887
Bone Neoplasms	Associate	17982618
Bone Resorption	Associate	16936272, 16960694
Breast Neoplasms	Associate	21559440, 22824341, 26781475, 27191503, 27893411, 28577080, 28758931, 29932437, 35697931
Calcinosis	Associate	16449517
Calcinosis Cutis	Stimulate	21407234
Carcinogenesis	Associate	34570303
Carcinoma Giant Cell	Associate	35697931
Carcinoma Ovarian Epithelial	Associate	35163671
Carcinoma Renal Cell	Associate	26528707
Cardiomegaly	Associate	12929927
Cardiovascular Diseases	Associate	22001292
Cataract	Associate	32180680
Cognition Disorders	Associate	35858838
Colonic Neoplasms	Associate	33985413, 36646765
Colorectal Neoplasms	Associate	34541005
COVID 19	Associate	36818472
Cysts	Associate	21683340
Delayed Emergence from Anesthesia	Associate	24081232
Dentigerous Cyst	Associate	21683340
Diabetes Mellitus	Associate	21659498
Disease	Associate	11771666, 31923705
Dysosteosclerosis	Associate	31163101
Edema	Associate	12568416
Endometrial Neoplasms	Associate	29932437
Esophageal Neoplasms	Associate	25019155, 25973136
Esophageal Squamous Cell Carcinoma	Associate	25019155, 25973136
Expansile Bone Lesions	Associate	31923705, 36740137
Familial Paget's disease of bone	Associate	36740137
Femur Head Necrosis	Associate	26617755
Fibrous Dysplasia Polyostotic	Associate	21987421
Frailty	Associate	37254268
Giant Cell Tumor of Tendon Sheath	Associate	31189751
Glioma	Associate	22787434
Hearing Loss	Associate	12568416, 12929927, 31923705, 40222603
Heart Failure Diastolic	Associate	34685778
Heart Valve Diseases	Associate	16449517, 27003233
Hip Injuries	Inhibit	21760914
Hip Injuries	Associate	21760914
Hodgkin Disease	Associate	11675352
Hypercalcemia	Associate	11781248, 12929927, 22271396, 31923705, 40222603
Hyperostosis corticalis deformans juvenilis	Associate	11771666, 12929927, 20564239, 21987421, 25063546, 31923705, 32298837
Immunologic Deficiency Syndromes	Associate	18606301
Inflammation	Associate	27003233, 34685778
Iron Overload	Associate	37532711
Kidney Diseases	Associate	25478860
Kidney Neoplasms	Associate	37407978
Leukemia Lymphoma Adult T Cell	Associate	11781248
Liver Cirrhosis Biliary	Associate	27054952
Lymphatic Metastasis	Stimulate	25973136
Lymphoma Large B Cell Diffuse	Associate	19412164
Melanoma	Associate	21407234
Monckeberg Medial Calcific Sclerosis	Associate	21659498
Multiple Myeloma	Associate	26762414, 36251145
Musculoskeletal Diseases	Associate	12929927
Myalgia	Associate	28619088
Myasthenia Gravis	Associate	25643325, 35074870
Neoplasm Metastasis	Associate	21559440, 26528707, 27191503, 28577080
Neoplasms	Associate	21559440, 23369128, 31992773, 35163671, 39273449
Neoplasms	Stimulate	26781475
Obesity	Associate	16960694
Oculocerebrorenal Syndrome	Associate	31923705
Odontogenic Cysts	Associate	21643971, 33768738
Osteitis Deformans	Associate	11149487, 11473345, 11742440, 12929927, 19578385, 19925894, 20436471, 20564239, 21623375, 21987421, 31923705
Osteoarthritis Knee	Associate	30921190
Osteolysis	Associate	21643971, 21659498, 33768738
Osteonecrosis	Associate	25820558, 26617755
Osteopetrosis	Associate	18606301, 20564239, 22271396, 24108692, 32097281, 34049530
Osteopetrosis Autosomal Recessive 1	Associate	19507210
Osteopetrosis Autosomal Recessive 7	Associate	31163101
Osteopetrosis mild autosomal recessive form	Associate	18606301, 22271396, 28816234
Osteoporosis	Associate	22370887, 34049530
Osteoporotic Fractures	Associate	22370887
Osteosarcoma	Associate	17982618, 38468522
Pain	Associate	12568416
Polyostotic osteolytic dysplasia hereditary expansile	Associate	11555792, 11742440, 11771666, 12568416, 12929927, 20564239, 31923705, 36740137
Radicular Cyst	Associate	21643971
Root Resorption	Associate	40222603
Stomach Neoplasms	Associate	30015970, 35421138
Tachycardia Sinoatrial Nodal Reentry	Stimulate	34737220
Tendinopathy	Associate	40222603
Tibial Neuropathy	Associate	12568416
Tooth Loss	Associate	12929927, 31923705
Transfusion Reaction	Associate	35858838, 37532711
Uterine Cervical Dysplasia	Stimulate	25973136
Uterine Cervical Neoplasms	Associate	32616510
Vascular Calcification	Associate	21659498
Weight Loss	Associate	24081232
Wiskott Aldrich Syndrome	Associate	32097281
Zellweger Syndrome	Associate	21987421

TNFRSF11A (TNF receptor superfamily member 11a)