Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8772
Gene name Gene Name - the full gene name approved by the HGNC.	Fas associated via death domain
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FADD
Synonyms (NCBI Gene) Gene synonyms aliases	GIG3, IMD90, MORT1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis fact

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs369869993	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs387906839	T>G	Pathogenic	Missense variant, coding sequence variant
rs863224871	AGCGAGC>-	Likely-pathogenic	Stop gained, coding sequence variant
rs1392069885	G>A	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000638	hsa-miR-146a-5p	Luciferase reporter assay	19965651
MIRT006848	hsa-miR-155-5p	GFP reporter assay, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21706480
MIRT006848	hsa-miR-155-5p	GFP reporter assay, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21706480
MIRT023826	hsa-miR-1-3p	Microarray	18668037
MIRT025869	hsa-miR-7-5p	Sequencing	20371350
MIRT046456	hsa-miR-15b-5p	CLASH	23622248
MIRT736414	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT974914	hsa-miR-1178	CLIP-seq
MIRT974915	hsa-miR-1287	CLIP-seq
MIRT974916	hsa-miR-1288	CLIP-seq
MIRT974917	hsa-miR-28-5p	CLIP-seq
MIRT974918	hsa-miR-3135b	CLIP-seq
MIRT974919	hsa-miR-3139	CLIP-seq
MIRT974920	hsa-miR-3140-3p	CLIP-seq
MIRT974921	hsa-miR-3156-5p	CLIP-seq
MIRT974922	hsa-miR-3159	CLIP-seq
MIRT974923	hsa-miR-3169	CLIP-seq
MIRT974924	hsa-miR-320a	CLIP-seq
MIRT974925	hsa-miR-320b	CLIP-seq
MIRT974926	hsa-miR-320c	CLIP-seq
MIRT974927	hsa-miR-320d	CLIP-seq
MIRT974928	hsa-miR-3591-5p	CLIP-seq
MIRT974929	hsa-miR-3670	CLIP-seq
MIRT974930	hsa-miR-3681	CLIP-seq
MIRT974931	hsa-miR-382	CLIP-seq
MIRT974932	hsa-miR-4302	CLIP-seq
MIRT974933	hsa-miR-4429	CLIP-seq
MIRT974934	hsa-miR-4460	CLIP-seq
MIRT974935	hsa-miR-4462	CLIP-seq
MIRT974936	hsa-miR-4638-3p	CLIP-seq
MIRT974937	hsa-miR-4722-5p	CLIP-seq
MIRT974938	hsa-miR-4724-3p	CLIP-seq
MIRT974939	hsa-miR-4727-3p	CLIP-seq
MIRT974940	hsa-miR-4729	CLIP-seq
MIRT974941	hsa-miR-606	CLIP-seq
MIRT974942	hsa-miR-633	CLIP-seq
MIRT974943	hsa-miR-708	CLIP-seq
MIRT1988849	hsa-miR-1183	CLIP-seq
MIRT1988850	hsa-miR-128	CLIP-seq
MIRT1988851	hsa-miR-1343	CLIP-seq
MIRT1988852	hsa-miR-185	CLIP-seq
MIRT1988853	hsa-miR-1913	CLIP-seq
MIRT1988854	hsa-miR-193a-5p	CLIP-seq
MIRT1988855	hsa-miR-27a	CLIP-seq
MIRT1988856	hsa-miR-27b	CLIP-seq
MIRT1988857	hsa-miR-3074-5p	CLIP-seq
MIRT1988858	hsa-miR-3128	CLIP-seq
MIRT1988859	hsa-miR-323-5p	CLIP-seq
MIRT1988860	hsa-miR-324-3p	CLIP-seq
MIRT1988861	hsa-miR-3665	CLIP-seq
MIRT1988862	hsa-miR-3667-3p	CLIP-seq
MIRT1988863	hsa-miR-3688-3p	CLIP-seq
MIRT1988864	hsa-miR-3690	CLIP-seq
MIRT1988865	hsa-miR-370	CLIP-seq
MIRT1988866	hsa-miR-377	CLIP-seq
MIRT1988867	hsa-miR-378g	CLIP-seq
MIRT1988868	hsa-miR-3919	CLIP-seq
MIRT1988869	hsa-miR-3925-5p	CLIP-seq
MIRT1988870	hsa-miR-412	CLIP-seq
MIRT1988871	hsa-miR-4254	CLIP-seq
MIRT1988872	hsa-miR-4274	CLIP-seq
MIRT1988873	hsa-miR-4306	CLIP-seq
MIRT1988874	hsa-miR-4330	CLIP-seq
MIRT1988875	hsa-miR-4474-3p	CLIP-seq
MIRT1988876	hsa-miR-4519	CLIP-seq
MIRT1988877	hsa-miR-4524	CLIP-seq
MIRT1988878	hsa-miR-4527	CLIP-seq
MIRT1988879	hsa-miR-4644	CLIP-seq
MIRT1988880	hsa-miR-4645-5p	CLIP-seq
MIRT1988881	hsa-miR-4673	CLIP-seq
MIRT974938	hsa-miR-4724-3p	CLIP-seq
MIRT1988882	hsa-miR-4731-5p	CLIP-seq
MIRT1988883	hsa-miR-4738-3p	CLIP-seq
MIRT1988884	hsa-miR-4749-3p	CLIP-seq
MIRT1988885	hsa-miR-4756-3p	CLIP-seq
MIRT1988886	hsa-miR-512-3p	CLIP-seq
MIRT1988887	hsa-miR-512-5p	CLIP-seq
MIRT1988888	hsa-miR-513a-5p	CLIP-seq
MIRT1988889	hsa-miR-516a-3p	CLIP-seq
MIRT1988890	hsa-miR-548g	CLIP-seq
MIRT1988891	hsa-miR-589	CLIP-seq
MIRT1988850	hsa-miR-128	CLIP-seq
MIRT1988851	hsa-miR-1343	CLIP-seq
MIRT1988854	hsa-miR-193a-5p	CLIP-seq
MIRT1988855	hsa-miR-27a	CLIP-seq
MIRT1988856	hsa-miR-27b	CLIP-seq
MIRT2223236	hsa-miR-2861	CLIP-seq
MIRT2223237	hsa-miR-3065-3p	CLIP-seq
MIRT1988857	hsa-miR-3074-5p	CLIP-seq
MIRT2223238	hsa-miR-3160-3p	CLIP-seq
MIRT974928	hsa-miR-3591-5p	CLIP-seq
MIRT974929	hsa-miR-3670	CLIP-seq
MIRT974930	hsa-miR-3681	CLIP-seq
MIRT1988865	hsa-miR-370	CLIP-seq
MIRT2223239	hsa-miR-3921	CLIP-seq
MIRT1988870	hsa-miR-412	CLIP-seq
MIRT2223240	hsa-miR-4286	CLIP-seq
MIRT2223241	hsa-miR-4303	CLIP-seq
MIRT974934	hsa-miR-4460	CLIP-seq
MIRT2223242	hsa-miR-4487	CLIP-seq
MIRT2223243	hsa-miR-4653-5p	CLIP-seq
MIRT974939	hsa-miR-4727-3p	CLIP-seq
MIRT974940	hsa-miR-4729	CLIP-seq
MIRT1988882	hsa-miR-4731-5p	CLIP-seq
MIRT2223244	hsa-miR-4757-5p	CLIP-seq
MIRT1988886	hsa-miR-512-3p	CLIP-seq
MIRT1988887	hsa-miR-512-5p	CLIP-seq
MIRT1988888	hsa-miR-513a-5p	CLIP-seq
MIRT1988889	hsa-miR-516a-3p	CLIP-seq
MIRT2223245	hsa-miR-558	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
DEDD	Unknown	17193921
RUNX3	Activation	17956589

Show/Hide all(75)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002020	Function	Protease binding	IPI	9208847, 21785459
GO:0002821	Process	Positive regulation of adaptive immune response	ISS
GO:0005123	Function	Death receptor binding	IBA	21873635
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7536190, 7538907, 8681376, 9208847, 9343261, 10442631, 10880445, 11112409, 12702765, 12887920, 14612908, 15688372, 16127453, 16498403, 17047155, 17159907, 18328427, 18485876, 18846110, 19060883, 19118384, 19176810, 19524512, 19524513, 20103630, 20890306, 20935634, 21382479, 21458669
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	22510408
GO:0005829	Component	Cytosol	IDA	21785459
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	22510408
GO:0006915	Process	Apoptotic process	IMP	22891283
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	TAS
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	7538907
GO:0016032	Process	Viral process	IEA
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870, 21803845
GO:0031264	Component	Death-inducing signaling complex	TAS	18309324
GO:0031265	Component	CD95 death-inducing signaling complex	IBA	21873635
GO:0031265	Component	CD95 death-inducing signaling complex	IDA	20935634
GO:0032729	Process	Positive regulation of interferon-gamma production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	16127453
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	16127453
GO:0032813	Function	Tumor necrosis factor receptor superfamily binding	IPI	21109225
GO:0033077	Process	T cell differentiation in thymus	ISS
GO:0033612	Function	Receptor serine/threonine kinase binding	IEA
GO:0034138	Process	Toll-like receptor 3 signaling pathway	TAS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0035877	Function	Death effector domain binding	IPI	11717445
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IBA	21873635
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0042104	Process	Positive regulation of activated T cell proliferation	ISS
GO:0042802	Function	Identical protein binding	IPI	7536190, 8681376, 25502805, 30561431, 31515488, 32296183
GO:0043005	Component	Neuron projection	IEA
GO:0043029	Process	T cell homeostasis	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	11821383
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20935634
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0043278	Process	Response to morphine	IEA
GO:0044297	Component	Cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0048536	Process	Spleen development	ISS
GO:0048538	Process	Thymus development	ISS
GO:0051607	Process	Defense response to virus	IMP	21109225
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IMP	21109225
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0070236	Process	Negative regulation of activation-induced cell death of T cells	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071550	Process	Death-inducing signaling complex assembly	TAS
GO:0089720	Function	Caspase binding	IBA	21873635
GO:0089720	Function	Caspase binding	IPI	9343261
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	IDA	11101870
GO:0097190	Process	Apoptotic signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	16611992
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	18309324
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097202	Process	Activation of cysteine-type endopeptidase activity	IDA	18387192
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0097527	Process	Necroptotic signaling pathway	IMP	11101870
GO:1902041	Process	Regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS
GO:2000454	Process	Positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IBA	21873635
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013

MIM	HGNC	e!Ensembl
602457	3573	ENSG00000168040

Protein

UniProt ID

Q13158

Protein name

FAS-associated death domain protein (FAS-associating death domain-containing protein) (Growth-inhibiting gene 3 protein) (Mediator of receptor induced toxicity)

Protein function

Apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to the activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors (PubMed:16762833, PubMed:19118384, PubMed:20935634, PubMed:23955153, PubMed:24025841, PubMed:7538907, PubMed:9184224). The r

PDB

1A1W , 1A1Z , 1E3Y , 1E41 , 2GF5 , 3EZQ , 3OQ9 , 6ACI , 7LXC , 8YBX , 8YD7 , 8YD8 , 8YNI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01335	DED	4 → 85	Death effector domain	Domain
PF00531	Death	98 → 181	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes. {ECO:0000269|PubMed:7538907}.

Sequence

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS

Sequence length

208

Interactions

View interactions

	KEGG		Reactome
	Platinum drug resistance Apoptosis Apoptosis - multiple species Necroptosis Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway IL-17 signaling pathway TNF signaling pathway Alcoholic liver disease Alzheimer disease Pathways of neurodegeneration - multiple diseases Pathogenic Escherichia coli infection Salmonella infection Chagas disease Tuberculosis Hepatitis C Hepatitis B Measles Human cytomegalovirus infection Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Pathways in cancer		Caspase activation via Death Receptors in the presence of ligand TRIF-mediated programmed cell death Regulation by c-FLIP RIPK1-mediated regulated necrosis CASP8 activity is inhibited TNFR1-induced proapoptotic signaling Dimerization of procaspase-8 FasL/ CD95L signaling TRAIL signaling TLR3-mediated TICAM1-dependent programmed cell death NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Epileptic encephalopathy	Encephalopathies	rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625 View all (860 more)
Hearing loss	Sensorineural Hearing Loss (disorder), Sensory hearing loss	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)	17656375
Ventricular septal defect	Ventricular Septal Defects	rs104894073, rs387906775

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Coronary artery disease	Coronary artery disease			GWAS

Show/Hide Text Mining Associations (75)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	16109772, 35029906
Aggressive Periodontitis	Associate	28883894
Alzheimer Disease	Associate	39396083
Aortic Dissection	Associate	35480868
Arthritis Rheumatoid	Associate	10817565
Arthritis Rheumatoid	Inhibit	16951485
Autoimmune Lymphoproliferative Syndrome	Associate	10200300, 33995372
Breast Neoplasms	Associate	16450001, 18840411, 24886289, 27013580, 27388253, 31443698
Burkitt Lymphoma	Associate	10477698, 21315423
Carcinogenesis	Associate	27013580
Carcinoma Ductal Breast	Associate	24886289
Carcinoma Hepatocellular	Stimulate	37666920
Carcinoma in Situ	Stimulate	17187659
Carcinoma Lobular	Associate	27078887
Carcinoma Non Small Cell Lung	Associate	33104018, 35909476
Carcinoma Squamous Cell	Associate	36138066
Cardiovascular Diseases	Associate	37798313
Colorectal Neoplasms	Associate	27622714, 28061540, 33076720
Death	Associate	11279061
Drug Related Side Effects and Adverse Reactions	Associate	10075697, 16450001, 21135115, 24651037, 31830245
Esophageal Squamous Cell Carcinoma	Stimulate	17187659
Esophageal Squamous Cell Carcinoma	Associate	19728877
Head and Neck Neoplasms	Associate	23974629
Heart Failure	Associate	37798313
HIV Infections	Associate	30344003, 30653393
Hodgkin Disease	Associate	15078899
Idiopathic Pulmonary Fibrosis	Associate	11334117
Inflammation	Associate	24037645
Kashin Beck Disease	Associate	31762289
Laryngeal Neoplasms	Associate	22208968
Leukemia	Associate	11514566, 12506034, 35637951
Leukemia Large Granular Lymphocytic	Associate	17993614
Leukemia Lymphocytic Chronic B Cell	Associate	21315423
Leukemia Myeloid Acute	Associate	11739185, 37367830
Leukemia T Cell	Associate	23096115
Lung Diseases	Associate	33104018
Lung Neoplasms	Associate	37864090
Lupus Erythematosus Systemic	Associate	19644848
Lymphatic Metastasis	Associate	18268491, 27388253
Lymphatic Metastasis	Stimulate	23358467, 23974629, 27764170
Lymphoma B Cell	Associate	10468853, 15009062, 21315423
Lymphoma Follicular	Associate	21315423
Lymphoma Large B Cell Diffuse	Associate	21315423
Lymphoma Mantle Cell	Associate	11468180, 21315423
Lymphoma T Cell	Associate	9375749
Malformations of Cortical Development Group I	Associate	26025363
Mouth Neoplasms	Associate	19479204, 23974629, 35421271
Multiple Myeloma	Associate	21315423
Myelodysplastic Syndromes	Associate	15677568
Neoplasm Metastasis	Associate	16450001
Neoplasms	Associate	10075697, 11279061, 12529427, 15991280, 16109772, 16450001, 17203870, 21315423, 26009898, 27013580, 27764170, 29757984, 33133307, 38002938
Neoplasms	Inhibit	36499482
Neoplasms Squamous Cell	Associate	36499482
Nerve Degeneration	Associate	19176810, 27832104
Neurodegenerative Diseases	Inhibit	19176810
Osteoarthritis	Associate	31762289
Ovarian Neoplasms	Associate	28504421
Pancreatic Neoplasms	Associate	14583775, 32504778
Pharyngeal Neoplasms	Associate	27764170
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	35637951
Primary Immunodeficiency Diseases	Associate	38644452
Prostatic Intraepithelial Neoplasia	Associate	17203870
Prostatic Neoplasms	Associate	17203870
Retinal Dysplasia	Associate	17187659
Sarcoma	Associate	17643097
Sleep Deprivation	Associate	30551620
Squamous Cell Carcinoma of Head and Neck	Associate	17026852, 23358467, 24278325, 26914121, 27764170, 32065407, 33227411, 33456497, 34423028
Stomach Neoplasms	Associate	12439910, 15991280
Tarlov Cysts	Associate	24886289
Tertiary Lymphoid Structures	Associate	27388253
Testicular Germ Cell Tumor	Associate	17643097
Triple Negative Breast Neoplasms	Associate	35631261, 37093683
Tuberculosis Pulmonary	Associate	32887662
Uterine Cervical Dysplasia	Associate	30567904
Uterine Cervical Neoplasms	Associate	15197583, 30567904

FADD (Fas associated via death domain)