TNFRSF6B (TNF receptor superfamily member 6b)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 8771
Gene name TNF receptor superfamily member 6b
Gene symbol TNFRSF6B
Synonyms (NCBI Gene)
DCR3DJ583P15.1.1M68M68ETR6
Chromosome 20
Chromosome location 20q13.33
Summary This gene belongs to the tumor necrosis factor receptor superfamily. The encoded protein is postulated to play a regulatory role in suppressing FasL- and LIGHT-mediated cell death. It acts as a decoy receptor that competes with death receptors for ligand
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT004905 hsa-miR-34a-5p MicroarrayNorthern blot 17540599
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10318773, 21300286, 25087510, 25416956
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space NAS 10318773
GO:0006915 Process Apoptotic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603361 11921 ENSG00000243509
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95407
Protein name Tumor necrosis factor receptor superfamily member 6B (Decoy receptor 3) (DcR3) (Decoy receptor for Fas ligand) (M68)
Protein function Decoy receptor that can neutralize the cytotoxic ligands TNFS14/LIGHT, TNFSF15 and TNFSF6/FASL. Protects against apoptosis.
PDB 3K51 , 3MHD , 3MI8 , 4J6G , 4KGG , 4KGQ , 4MSV , 5L36
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 73 → 113 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 115 → 150 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 153 → 193 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal lung, brain and liver. Detected in adult stomach, spinal cord, lymph node, trachea, spleen, colon and lung. Highly expressed in several primary tumors from colon, stomach, rectum, esophagus and in SW480 colon carcinom
Sequence 
MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQR
PCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFF
AHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLA
LNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPE
GWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH
Sequence length 300
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
18
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Long QT syndrome Uncertain significance rs754782569 RCV000190158
TNFRSF6B-related disorder Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign rs540583157, rs376086304, rs142858927, rs375326054, rs200678279, rs1299161540, rs748457267, rs370197534, rs140974898, rs538491653, rs144974329, rs367883678, rs143141437, rs2517213834, rs750208461
View all (2 more)		 RCV003953677
RCV003393989
RCV003940956
RCV003418354
RCV003403664
RCV003401954
RCV003418335
RCV003960930
RCV003903510
RCV003970983
RCV003960920
RCV004753621
RCV003410411
RCV003414307
RCV003901331
RCV003902048
RCV003899428
Show/Hide Text Mining Associations (71)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute On Chronic Liver Failure Associate 31317042
Anemia Sickle Cell Associate 19251437
Arthritis Rheumatoid Associate 17393415, 20187130, 26956410
Arthritis Rheumatoid Stimulate 20592286
Autoimmune Diseases of the Nervous System Associate 10632670
Bacterial Infections Stimulate 14688085
Breast Neoplasms Associate 24612949, 30513096
Bronchiolitis Obliterans Syndrome Stimulate 33078555
Calcinosis Cutis Associate 18813347
Carcinogenesis Associate 25422191, 27517320