TNFRSF6B (TNF receptor superfamily member 6b)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8771
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 6b
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF6B
Synonyms (NCBI Gene) Gene synonyms aliases
DCR3, DJ583P15.1.1, M68, M68E, TR6
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the tumor necrosis factor receptor superfamily. The encoded protein is postulated to play a regulatory role in suppressing FasL- and LIGHT-mediated cell death. It acts as a decoy receptor that competes with death receptors for ligand
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT004905 hsa-miR-34a-5p Microarray, Northern blot 17540599
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10318773, 21300286, 25087510, 25416956
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space NAS 10318773
GO:0006915 Process Apoptotic process IEA
GO:0033209 Process Tumor necrosis factor-mediated signaling pathway TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603361 11921 ENSG00000243509
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95407
Protein name Tumor necrosis factor receptor superfamily member 6B (Decoy receptor 3) (DcR3) (Decoy receptor for Fas ligand) (M68)
Protein function Decoy receptor that can neutralize the cytotoxic ligands TNFS14/LIGHT, TNFSF15 and TNFSF6/FASL. Protects against apoptosis.
PDB 3K51 , 3MHD , 3MI8 , 4J6G , 4KGG , 4KGQ , 4MSV , 5L36
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 73 → 113 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 115 → 150 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 153 → 193 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal lung, brain and liver. Detected in adult stomach, spinal cord, lymph node, trachea, spleen, colon and lung. Highly expressed in several primary tumors from colon, stomach, rectum, esophagus and in SW480 colon carcinom
Sequence 
MRALEGPGLSLLCLVLALPALLPVPAVRGVAETPTYPWRDAETGERLVCAQCPPGTFVQR
PCRRDSPTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEEARACHATHNRACRCRTGFF
AHAGFCLEHASCPPGAGVIAPGTPSQNTQCQPCPPGTFSASSSSSEQCQPHRNCTALGLA
LNVPGSSSHDTLCTSCTGFPLSTRVPGAEECERAVIDFVAFQDISIKRLQRLLQALEAPE
GWGPTPRAGRAALQLKLRRRLTELLGAQDGALLVRLLQALRVARMPGLERSVRERFLPVH
Sequence length 300
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Atopic rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 25574825
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 26192919, 28067908
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Show/Hide Unknown Diseases (14)
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 26974007, 28067908 ClinVar
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Glioma Glioma Knockdown of lncGRS-1, a primate-conserved, nuclear-enriched lncRNA, inhibits the growth and proliferation of primary adult and pediatric glioma cells, but not the viability of normal brain cells. GWAS, CBGDA
Ulcerative colitis Ulcerative colitis GWAS
Show/Hide Text Mining Associations (71)
Associations from Text Mining
Disease Name Relationship Type References
Acute On Chronic Liver Failure Associate 31317042
Anemia Sickle Cell Associate 19251437
Arthritis Rheumatoid Associate 17393415, 20187130, 26956410
Arthritis Rheumatoid Stimulate 20592286
Autoimmune Diseases of the Nervous System Associate 10632670
Bacterial Infections Stimulate 14688085
Breast Neoplasms Associate 24612949, 30513096
Bronchiolitis Obliterans Syndrome Stimulate 33078555
Calcinosis Cutis Associate 18813347
Carcinogenesis Associate 25422191, 27517320