Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8767
Gene name Gene Name - the full gene name approved by the HGNC.	Receptor interacting serine/threonine kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIPK2
Synonyms (NCBI Gene) Gene synonyms aliases	CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both

Show/Hide all(25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024084	hsa-miR-1-3p	Microarray	18668037
MIRT027839	hsa-miR-98-5p	Microarray	19088304
MIRT1307617	hsa-miR-1290	CLIP-seq
MIRT1307618	hsa-miR-200b	CLIP-seq
MIRT1307619	hsa-miR-200c	CLIP-seq
MIRT1307620	hsa-miR-3133	CLIP-seq
MIRT1307621	hsa-miR-320a	CLIP-seq
MIRT1307622	hsa-miR-320b	CLIP-seq
MIRT1307623	hsa-miR-320c	CLIP-seq
MIRT1307624	hsa-miR-320d	CLIP-seq
MIRT1307625	hsa-miR-3545-3p	CLIP-seq
MIRT1307626	hsa-miR-3668	CLIP-seq
MIRT1307627	hsa-miR-3680	CLIP-seq
MIRT1307628	hsa-miR-374c	CLIP-seq
MIRT1307629	hsa-miR-429	CLIP-seq
MIRT1307630	hsa-miR-4429	CLIP-seq
MIRT1307631	hsa-miR-4699-3p	CLIP-seq
MIRT1307632	hsa-miR-4798-3p	CLIP-seq
MIRT1307633	hsa-miR-548b-3p	CLIP-seq
MIRT1307634	hsa-miR-548p	CLIP-seq
MIRT1307635	hsa-miR-655	CLIP-seq
MIRT1553111	hsa-miR-495	CLIP-seq
MIRT1553112	hsa-miR-802	CLIP-seq
MIRT2091169	hsa-miR-487a	CLIP-seq
MIRT2315924	hsa-miR-3185	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Activation	19693652
RELA	Activation	19693652

Show/Hide all(86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IEA
GO:0002250	Process	Adaptive immune response	IBA	21873635
GO:0002250	Process	Adaptive immune response	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0004672	Function	Protein kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004706	Function	JUN kinase kinase kinase activity	IBA	21873635
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005102	Function	Signaling receptor binding	IPI	24790089
GO:0005515	Function	Protein binding	IPI	11432859, 11536016, 15383541, 16418290, 17054981, 19337385, 19667203, 21887730, 21903422, 21931591, 21931826, 22829933, 23333941, 23818254, 25416956, 27812135, 28436939, 29997244, 31515488
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	21887730
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	21887730
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	TAS	9705938
GO:0007165	Process	Signal transduction	TAS	9642260
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	ISS
GO:0007254	Process	JNK cascade	TAS
GO:0007256	Process	Activation of JNKK activity	IEA
GO:0007257	Process	Activation of JUN kinase activity	IBA	21873635
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IDA	21887730
GO:0010942	Process	Positive regulation of cell death	IDA	16920334
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0030274	Function	LIM domain binding	IPI	15657077
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	15620648
GO:0031398	Process	Positive regulation of protein ubiquitination	NAS	22412986
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031982	Component	Vesicle	IDA	21887730
GO:0032092	Process	Positive regulation of protein binding	IMP	11432859
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032727	Process	Positive regulation of interferon-alpha production	NAS	22412986
GO:0032728	Process	Positive regulation of interferon-beta production	NAS	22412986
GO:0032729	Process	Positive regulation of interferon-gamma production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	11432859
GO:0032735	Process	Positive regulation of interleukin-12 production	NAS	22412986
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032991	Component	Protein-containing complex	IDA	11536016, 15383541, 21887730
GO:0032991	Component	Protein-containing complex	IMP	11432859
GO:0033091	Process	Positive regulation of immature T cell proliferation	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	21887730
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IDA	11894098
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	19337385
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	10329646
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IDA	23806334
GO:0045087	Process	Innate immune response	ISS
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	22412986
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046641	Process	Positive regulation of alpha-beta T cell proliferation	IEA
GO:0050700	Function	CARD domain binding	IDA	10329646
GO:0050700	Function	CARD domain binding	IPI	11087742
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	21887730
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	11821383
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21887730, 21931591
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070427	Process	Nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070431	Process	Nucleotide-binding oligomerization domain containing 2 signaling pathway	IDA	23806334
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070671	Process	Response to interleukin-12	IEA
GO:0070673	Process	Response to interleukin-18	IEA
GO:0071223	Process	Cellular response to lipoteichoic acid	IEA
GO:0071224	Process	Cellular response to peptidoglycan	IEA
GO:0071225	Process	Cellular response to muramyl dipeptide	IDA	21887730
GO:0089720	Function	Caspase binding	IPI	11432859, 11536016, 15383541
GO:0097202	Process	Activation of cysteine-type endopeptidase activity	IDA	11821383
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1904417	Process	Positive regulation of xenophagy	IEA

MIM	HGNC	e!Ensembl
603455	10020	ENSG00000104312

Protein

UniProt ID

O43353

Protein name

Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (CARD-containing interleukin-1 beta-converting enzyme-associated kinase) (CARD-containing IL-1 beta ICE-kinase) (RIP-like-interacting CLARP kinase) (Receptor-interacting protein 2) (RIP-

Protein function

Serine/threonine/tyrosine-protein kinase that plays an essential role in modulation of innate and adaptive immune responses (PubMed:14638696, PubMed:17054981, PubMed:21123652, PubMed:28656966, PubMed:9575181, PubMed:9642260). Acts as a key effec

PDB

2N7Z , 2N83 , 4C8B , 5AR2 , 5AR3 , 5AR4 , 5AR5 , 5AR7 , 5AR8 , 5J79 , 5J7B , 5NG0 , 5NG2 , 5NG3 , 5W5J , 5W5O , 5YRN , 6ES0 , 6FU5 , 6GFJ , 6GGS , 6HMX , 6RN8 , 6RNA , 6S1F , 6SZE , 6SZJ , 6UL8 , 7OBS , 7OBT , 8AZA , 8X2O , 9F3V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	18 → 290	Protein tyrosine and serine/threonine kinase	Domain
PF00619	CARD	437 → 523	Caspase recruitment domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, brain, placenta, lung, peripheral blood leukocytes, spleen, kidney, testis, prostate, pancreas and lymph node. {ECO:0000269|PubMed:9575181, ECO:0000269|PubMed:9642260}.

Sequence

MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Sequence length

540

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Neurotrophin signaling pathway Shigellosis Salmonella infection Tuberculosis		NOD1/2 Signaling Pathway Downstream TCR signaling p75NTR recruits signalling complexes TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 Ovarian tumor domain proteases Interleukin-1 signaling

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Leprosy	Leprosy	20018961, 22019778	ClinVar, GWAS
Crohn Disease	Crohn Disease		GWAS

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Lung Injury	Associate	24658576
Adenocarcinoma of Lung	Associate	35907206
Aggressive Periodontitis	Associate	28883894
Bacterial Infections	Associate	35508972
Behcet Syndrome	Associate	28166214, 29907633
Bone Marrow Diseases	Associate	36567775
Breast Neoplasms	Associate	25186909, 27251275
Carcinogenesis	Associate	24817964
Carcinoma Pancreatic Ductal	Associate	33204717
Carcinoma Renal Cell	Associate	33790054
Cartilage Diseases	Associate	18205922
Chronic Periodontitis	Associate	22828789
Colorectal Neoplasms	Associate	32535071, 34356990
Crohn Disease	Associate	15620648
Dermatitis Atopic 3	Associate	17075290
Glioma	Associate	33069830, 37914353
Inflammation	Stimulate	20118240
Inflammation	Associate	23149220, 23818254, 24642040, 29463017, 34356990, 35477477, 35508972, 36983040
Inflammatory Bowel Diseases	Associate	36983040
Kidney Neoplasms	Associate	33790054
Leprosy	Associate	20018961, 24015287
Leprosy Paucibacillary	Associate	20018961
Lymphoma Large B Cell Diffuse	Associate	36567775
Lymphoproliferative Syndrome X Linked 2	Associate	23818254
Metabolic Syndrome	Associate	26052894
Mouth Neoplasms	Associate	32041789
Muscular Dystrophy Duchenne	Associate	36619896
Neoplasm Metastasis	Associate	33790054
Neoplasms	Associate	24642040, 33204717, 34356990, 35477477, 35508972, 36567775
Neoplasms	Stimulate	33790054
Ovarian Neoplasms	Associate	35477477
Parkinson Disease	Associate	36593912
Respiratory Distress Syndrome	Associate	24658576
Sarcoidosis	Associate	27402699
Sezary Syndrome	Associate	27039262
Smoke Inhalation Injury	Stimulate	36353608
Squamous Cell Carcinoma of Head and Neck	Associate	24817964, 27557518, 36353608
Triple Negative Breast Neoplasms	Associate	24642040, 33297339

RIPK2 (receptor interacting serine/threonine kinase 2)