Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8751
Gene name Gene Name - the full gene name approved by the HGNC.	ADAM metallopeptidase domain 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADAM15
Synonyms (NCBI Gene) Gene synonyms aliases	MDC15
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytoki

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022149	hsa-miR-124-3p	Microarray	18668037
MIRT050739	hsa-miR-18a-5p	CLASH	23622248
MIRT053385	hsa-miR-363-3p	qRT-PCR	23806264
MIRT735210	hsa-miR-3174	qRT-PCR	32547057
MIRT765942	hsa-miR-1273e	CLIP-seq
MIRT765943	hsa-miR-2277-3p	CLIP-seq
MIRT765944	hsa-miR-3659	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765946	hsa-miR-1247	CLIP-seq
MIRT765942	hsa-miR-1273e	CLIP-seq
MIRT765947	hsa-miR-137	CLIP-seq
MIRT765948	hsa-miR-147b	CLIP-seq
MIRT765943	hsa-miR-2277-3p	CLIP-seq
MIRT765949	hsa-miR-25	CLIP-seq
MIRT765950	hsa-miR-32	CLIP-seq
MIRT765951	hsa-miR-326	CLIP-seq
MIRT765952	hsa-miR-330-5p	CLIP-seq
MIRT765953	hsa-miR-363	CLIP-seq
MIRT765944	hsa-miR-3659	CLIP-seq
MIRT765954	hsa-miR-3667-3p	CLIP-seq
MIRT765955	hsa-miR-367	CLIP-seq
MIRT765956	hsa-miR-4438	CLIP-seq
MIRT765957	hsa-miR-4468	CLIP-seq
MIRT765958	hsa-miR-4652-5p	CLIP-seq
MIRT765959	hsa-miR-4704-3p	CLIP-seq
MIRT765960	hsa-miR-4754	CLIP-seq
MIRT765961	hsa-miR-508-5p	CLIP-seq
MIRT765962	hsa-miR-520a-5p	CLIP-seq
MIRT765963	hsa-miR-525-5p	CLIP-seq
MIRT765964	hsa-miR-566	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765965	hsa-miR-891b	CLIP-seq
MIRT765966	hsa-miR-92a	CLIP-seq
MIRT765967	hsa-miR-92b	CLIP-seq
MIRT765947	hsa-miR-137	CLIP-seq
MIRT765949	hsa-miR-25	CLIP-seq
MIRT765950	hsa-miR-32	CLIP-seq
MIRT765951	hsa-miR-326	CLIP-seq
MIRT765952	hsa-miR-330-5p	CLIP-seq
MIRT765953	hsa-miR-363	CLIP-seq
MIRT765955	hsa-miR-367	CLIP-seq
MIRT765956	hsa-miR-4438	CLIP-seq
MIRT765957	hsa-miR-4468	CLIP-seq
MIRT1925697	hsa-miR-593	CLIP-seq
MIRT765945	hsa-miR-759	CLIP-seq
MIRT765965	hsa-miR-891b	CLIP-seq
MIRT765966	hsa-miR-92a	CLIP-seq
MIRT765967	hsa-miR-92b	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IMP	22505472
GO:0002418	Process	Immune response to tumor cell	IDA	22505472
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005178	Function	Integrin binding	IMP	22505472
GO:0005515	Function	Protein binding	IPI	10531379, 11741929, 15280379, 16374509, 25416956, 25825872
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IDA	22505472
GO:0007160	Process	Cell-matrix adhesion	TAS	9516430
GO:0007229	Process	Integrin-mediated signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	22505472
GO:0008237	Function	Metallopeptidase activity	IBA	21873635
GO:0008237	Function	Metallopeptidase activity	IDA	12777399
GO:0008584	Process	Male gonad development	IEA
GO:0009986	Component	Cell surface	IDA	22505472
GO:0016021	Component	Integral component of membrane	IEA
GO:0017124	Function	SH3 domain binding	IPI	10531379
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030308	Process	Negative regulation of cell growth	IMP	22505472
GO:0030336	Process	Negative regulation of cell migration	IMP	22505472
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0042246	Process	Tissue regeneration	IEA
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IDA	22505472
GO:0046872	Function	Metal ion binding	IEA
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0070062	Component	Extracellular exosome	IDA	22505472
GO:1900121	Process	Negative regulation of receptor binding	IMP	22505472
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IDA	22505472
GO:1990910	Process	Response to hypobaric hypoxia	IEA

MIM	HGNC	e!Ensembl
605548	193	ENSG00000143537

Protein

UniProt ID

Q13444

Protein name

Disintegrin and metalloproteinase domain-containing protein 15 (ADAM 15) (EC 3.4.24.-) (Metalloprotease RGD disintegrin protein) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15) (MDC-15) (Metargidin)

Protein function

Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-med

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	29 → 160	Reprolysin family propeptide	Family
PF01421	Reprolysin	213 → 414	Reprolysin (M12B) family zinc metalloprotease	Domain
PF00200	Disintegrin	430 → 503	Disintegrin	Domain
PF08516	ADAM_CR	508 → 627	ADAM cysteine-rich	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothe

Sequence

MRLALLWALGLLGAGSPLPSWPLPNIGGTEEQQAESEKAPREPLEPQVLQDDLPISLKKV
LQTSLPEPLRIKLELDGDSHILELLQNRELVPGRPTLVWYQPDGTRVVSEGHTLENCCYQ
GRVRGYAGSWVSICTCSGLRGLVVLTPERSYTLEQGPGDLQGPPIISRIQDLHLPGHTCA
LSWRESVHTQKPPEHPLGQRHIRRRRDVVTETKTVELVIVADHSEAQKYRDFQHLLNRTL
EVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDS
AQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDL
PGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPM
AAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQC
RPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQ
PAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLW
ETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSK
CHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTTGLLLSLLVLLVLVMLGASYWYRAR
LHQRLCQLKGPTCQYRAAQSGPSERPGPPQRALLARGTKQASALSFPAPPSRPLPPDPVS
KRLQAELADRPNPPTRPLPADPVVRSPKSQGPAKPPPPRKPLPADPQGRCPSGDLPGPGA
GIPPLVVPSRPAPPPPTVSSLYL

Sequence length

863

Interactions

View interactions

	Reactome
			Degradation of the extracellular matrix Invadopodia formation

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS
Dental caries	Dental caries		GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.	GWAS, CBGDA

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	16756724
Altitude Sickness	Associate	35668171
Arthritis Rheumatoid	Associate	11592366, 16277668, 23918525, 30634456
Breast Neoplasms	Associate	15565459, 16756724, 18296648, 18434311, 24317528, 31467400
Calcinosis Cutis	Stimulate	26930657
Carcinoma Hepatocellular	Associate	34426560
Carcinoma Hepatocellular	Stimulate	39346916
Cartilage Diseases	Associate	10513811, 11592366
Chondrosarcoma	Stimulate	10513811
Drug Hypersensitivity	Associate	32603359
IgA Vasculitis	Associate	16277668
Inflammation	Associate	17416588, 20189953, 23365087, 30634456
Inflammatory Bowel Diseases	Associate	16894352
Melanoma	Associate	10329602
Melanoma	Stimulate	21119930
Multiple Myeloma	Associate	39261477
Neoplasm Invasiveness	Associate	26930657
Neoplasms	Associate	17465204, 17937806, 18296648, 22677901, 24317528, 26930657, 28282546, 30265671, 30634456, 34426560
Neuroblastoma	Associate	19308291
Osteoarthritis	Stimulate	11592366
Pancreatic Neoplasms	Associate	17465204
Parkinson Disease	Associate	36504281
Prostatic Neoplasms	Associate	28282546, 36613831
Prostatitis	Associate	19308291, 24317528
Pulmonary Disease Chronic Obstructive	Stimulate	32677970
Squamous Cell Carcinoma of Head and Neck	Associate	25475780
Stomach Neoplasms	Associate	22677901
Synovial Cyst	Associate	11592366
Tachycardia Atrioventricular Nodal Reentry	Associate	28282546
Urinary Bladder Neoplasms	Associate	26930657

ADAM15 (ADAM metallopeptidase domain 15)