TNFSF9 (TNF superfamily member 9)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8744
Gene name Gene Name - the full gene name approved by the HGNC.
TNF superfamily member 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFSF9
Synonyms (NCBI Gene) Gene synonyms aliases
4-1BB-L, CD137L, TNLG5A
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molec
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(439)
miRTarBase ID miRNA Experiments Reference
MIRT001405 hsa-miR-16-5p pSILAC 18668040
MIRT017011 hsa-miR-335-5p Microarray 18185580
MIRT027516 hsa-miR-98-5p Microarray 19088304
MIRT028983 hsa-miR-26b-5p Microarray 19088304
MIRT001405 hsa-miR-16-5p Proteomics;Other 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 8088337
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005615 Component Extracellular space IEA
GO:0005886 Component Plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606182 11939 ENSG00000125657
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P41273
Protein name Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL)
Protein function Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. {ECO:00002
PDB 2X29 , 6A3V , 6BWV , 6CPR , 6CU0 , 6D3N , 6FIB , 6MGE , 6MGP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 107 → 240 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, placenta, lung, skeletal muscle and kidney.
Sequence 
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA
SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL
TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA
LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV
TPEIPAGLPSPRSE
Sequence length 254
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Contact Dermatitis rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 25724174
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)		 16367923
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Cleft Lip With Or Without Cleft Palate Cleft Lip With Or Without Cleft Palate GWAS
Show/Hide Text Mining Associations (44)
Associations from Text Mining
Disease Name Relationship Type References
Atherosclerosis Associate 24899613, 31631426
Breast Neoplasms Associate 26881506, 31182685
Calcinosis Cutis Associate 38191418
Carcinoma Ductal Associate 31182685
Carcinoma Hepatocellular Associate 14716821, 37903974
Carcinoma Pancreatic Ductal Associate 35718340
Carcinoma Renal Cell Associate 21483105
Carcinoma Squamous Cell Associate 18461674
Colorectal Neoplasms Associate 26872462
DiGeorge Syndrome Associate 35657354