Gene Gene information from NCBI Gene database.
Entrez ID 873
Gene name Carbonyl reductase 1
Gene symbol CBR1
Synonyms (NCBI Gene)
CBRPG-9-KRSDR21C1hCBR1
Chromosome 21
Chromosome location 21q22.12
Summary The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics
miRNA miRNA information provided by mirtarbase database.
104
miRTarBase ID miRNA Experiments Reference
MIRT049536 hsa-miR-92a-3p CLASH 23622248
MIRT045152 hsa-miR-186-5p CLASH 23622248
MIRT042005 hsa-miR-484 CLASH 23622248
MIRT038897 hsa-miR-93-3p CLASH 23622248
MIRT526062 hsa-miR-323a-3p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0004090 Function Carbonyl reductase (NADPH) activity IBA
GO:0004090 Function Carbonyl reductase (NADPH) activity IDA 1921984, 18449627
GO:0004090 Function Carbonyl reductase (NADPH) activity IEA
GO:0004090 Function Carbonyl reductase (NADPH) activity TAS 9740676
GO:0005515 Function Protein binding IPI 26496610, 28514442, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
114830 1548 ENSG00000159228
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P16152
Protein name Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.196, EC 1.1.1.197) (20-beta-hydroxysteroid dehydrogenase) (Alcohol dehydrogenase [NAD(P)+] CBR1) (EC 1.1.1.71) (NADPH-dependent carbonyl reductase 1) (
Protein function NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthrac
PDB 1WMA , 2PFG , 3BHI , 3BHJ , 3BHM , 4Z3D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 6 152 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney (at protein level). {ECO:0000269|PubMed:1597188}.
Sequence
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSP
ELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Sequence length 277
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Arachidonic acid metabolism
Folate biosynthesis
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - reactive oxygen species
  Synthesis of Prostaglandins (PG) and Thromboxanes (TX)