Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
873
Gene name Gene Name - the full gene name approved by the HGNC.
Carbonyl reductase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CBR1
Synonyms (NCBI Gene) Gene synonyms aliases
CBR, PG-9-KR, SDR21C1, hCBR1
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049536 hsa-miR-92a-3p CLASH 23622248
MIRT045152 hsa-miR-186-5p CLASH 23622248
MIRT042005 hsa-miR-484 CLASH 23622248
MIRT038897 hsa-miR-93-3p CLASH 23622248
MIRT526062 hsa-miR-323a-3p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004090 Function Carbonyl reductase (NADPH) activity IBA 21873635
GO:0004090 Function Carbonyl reductase (NADPH) activity IDA 18449627
GO:0005829 Component Cytosol TAS
GO:0016655 Function Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor IDA 19442656
GO:0017144 Process Drug metabolic process IDA 18449627
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
114830 1548 ENSG00000159228
Protein
UniProt ID P16152
Protein name Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.196, EC 1.1.1.197) (20-beta-hydroxysteroid dehydrogenase) (Alcohol dehydrogenase [NAD(P)+] CBR1) (EC 1.1.1.71) (NADPH-dependent carbonyl reductase 1) (
Protein function NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthrac
PDB 1WMA , 2PFG , 3BHI , 3BHJ , 3BHM , 4Z3D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00106 adh_short 6 152 short chain dehydrogenase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney (at protein level). {ECO:0000269|PubMed:1597188}.
Sequence
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFH
QLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSIMSVRALKSCSP
ELQQKFRSETITEEELVGLMNKFVEDTK
KGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKA
TKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Sequence length 277
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Arachidonic acid metabolism
Folate biosynthesis
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - reactive oxygen species
  Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cardiomyopathy Cardiomyopathies, Primary, Cardiomyopathies rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
11016643
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 21056497
Dermatitis Dermatitis, Irritant rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 25818598
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 30531928
Adenocarcinoma in Situ Associate 31568004
Aortic Aneurysm Abdominal Associate 26287481
Arthritis Rheumatoid Associate 26082314
Breast Neoplasms Associate 25003827, 25526449, 28618256
Cap Myopathy Associate 21178489
Carcinogenesis Associate 22121107, 23430757
Carcinogenesis Inhibit 23960441, 32917645
Carcinoma Hepatocellular Associate 24757656
Carcinoma Pancreatic Ductal Associate 29224225