Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8711
Gene name	Tyrosine kinase non receptor 1
Gene symbol	TNK1
Synonyms (NCBI Gene)	KOS1
Chromosome	17
Chromosome location	17p13.1
Summary	The protein encoded by this gene belongs to the tyrosine protein kinase family. Tyrosine protein kinases are important regulators of intracellular signal transduction pathways, mediating cellular proliferation, survival, and development. This gene is high

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051086	hsa-miR-16-5p	CLASH	23622248
MIRT1443684	hsa-miR-1272	CLIP-seq
MIRT1443685	hsa-miR-1322	CLIP-seq
MIRT1443686	hsa-miR-15a	CLIP-seq
MIRT1443687	hsa-miR-15b	CLIP-seq
MIRT1443688	hsa-miR-16	CLIP-seq
MIRT1443689	hsa-miR-195	CLIP-seq
MIRT1443690	hsa-miR-3171	CLIP-seq
MIRT1443691	hsa-miR-424	CLIP-seq
MIRT1443692	hsa-miR-4524	CLIP-seq
MIRT1443693	hsa-miR-4659a-3p	CLIP-seq
MIRT1443694	hsa-miR-4659b-3p	CLIP-seq
MIRT1443695	hsa-miR-4660	CLIP-seq
MIRT1443696	hsa-miR-497	CLIP-seq
MIRT1443697	hsa-miR-503	CLIP-seq
MIRT1443698	hsa-miR-646	CLIP-seq
MIRT2132766	hsa-miR-105	CLIP-seq
MIRT2132767	hsa-miR-1825	CLIP-seq
MIRT2132768	hsa-miR-199a-5p	CLIP-seq
MIRT2132769	hsa-miR-199b-5p	CLIP-seq
MIRT2132770	hsa-miR-2392	CLIP-seq
MIRT2132771	hsa-miR-338-3p	CLIP-seq
MIRT2132772	hsa-miR-4489	CLIP-seq
MIRT2132773	hsa-miR-4687-3p	CLIP-seq
MIRT2132774	hsa-miR-634	CLIP-seq
MIRT2132767	hsa-miR-1825	CLIP-seq
MIRT2132768	hsa-miR-199a-5p	CLIP-seq
MIRT2132769	hsa-miR-199b-5p	CLIP-seq
MIRT2132770	hsa-miR-2392	CLIP-seq
MIRT2353844	hsa-miR-23a	CLIP-seq
MIRT2353845	hsa-miR-23b	CLIP-seq
MIRT2353846	hsa-miR-23c	CLIP-seq
MIRT2353847	hsa-miR-4302	CLIP-seq
MIRT2132773	hsa-miR-4687-3p	CLIP-seq
MIRT2353848	hsa-miR-4717-3p	CLIP-seq
MIRT2353849	hsa-miR-644	CLIP-seq
MIRT2353850	hsa-miR-663b	CLIP-seq
MIRT2693759	hsa-miR-1285	CLIP-seq
MIRT2693760	hsa-miR-3187-5p	CLIP-seq
MIRT2693761	hsa-miR-326	CLIP-seq
MIRT2693762	hsa-miR-330-5p	CLIP-seq
MIRT2693763	hsa-miR-378g	CLIP-seq
MIRT2693764	hsa-miR-4268	CLIP-seq
MIRT2693765	hsa-miR-4437	CLIP-seq
MIRT2693766	hsa-miR-4486	CLIP-seq
MIRT2693767	hsa-miR-455-5p	CLIP-seq
MIRT2693768	hsa-miR-4674	CLIP-seq
MIRT2693769	hsa-miR-4691-5p	CLIP-seq
MIRT2693770	hsa-miR-4716-5p	CLIP-seq
MIRT2693771	hsa-miR-612	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IDA	10873601
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	10873601
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS	8632913
GO:0005515	Function	Protein binding	IPI	10873601, 15778465, 25852190, 32296183, 32707033, 36931259
GO:0005524	Function	ATP binding	IDA	10873601
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	10873601
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006468	Process	Protein phosphorylation	TAS	8632913
GO:0016020	Component	Membrane	IDA	10873601
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	10873601

MIM	HGNC	e!Ensembl
608076	11940	ENSG00000174292

Q13470

Protein name

Non-receptor tyrosine-protein kinase TNK1 (EC 2.7.10.2) (CD38 negative kinase 1)

Protein function

Involved in negative regulation of cell growth. Has tumor suppressor properties. Plays a negative regulatory role in the Ras-MAPK pathway. May function in signaling pathways utilized broadly during fetal development and more selectively in adult

PDB

7T8J , 7TCY , 7TDY , 7U4W , 7U4Z , 9CPL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	116 → 377	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all umbilical cord blood, bone marrow and adult blood cell sub-populations and in several leukemia cell lines. Highly expressed in fetal blood, brain, lung, liver and kidney. Detected at lower levels in adult prostate, tes

Sequence

MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCW
APHPADRPSFSHLEGLLQEAGPSEACCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST
IWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWD
APPARGQRRNMPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRP
PLSSSSPQPSQPSRERLPWPKRKPPHNHPMGMPGARKAAALSGGLLSDPELQRKIMEVEL
SVHGVTHQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCWRILEHYQWDLSAASR
YVLARP

Sequence length

666

Interactions

View interactions

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs7220814	RCV005935140
Cholangiocarcinoma	Benign	rs7220814	RCV005935147
Colon adenocarcinoma	Benign	rs7220814	RCV005935139
Colorectal cancer	Benign	rs7220814	RCV005935142
Familial cancer of breast	Benign	rs7220814	RCV005935138
Hepatocellular carcinoma	Benign	rs78397675	RCV005933360
Lymphoma	Benign	rs7220814	RCV005935144
Malignant lymphoma, large B-cell, diffuse	Benign	rs7220814	RCV005935141
Melanoma	Benign	rs7220814	RCV005935146
Sarcoma	Benign	rs7220814	RCV005935143
See cases	Uncertain significance	rs767381816	RCV005410924
Thymoma	Benign	rs7220814	RCV005935145
TNK1-related disorder	Benign; Likely benign	rs1554948, rs1554947, rs191861153, rs56093628, rs767495219, rs373258961, rs55939858, rs776157728, rs117725656, rs78397675, rs61730812, rs6503018, rs567484359, rs7220814, rs200198729, rs56159710, rs80015268 View all (2 more)	RCV003974479 RCV003984614 RCV003911355 RCV003911649 RCV003927332 RCV003964058 RCV003931475 RCV003949561 RCV003924390 RCV003954352 RCV003979235 RCV003982083 RCV003971834 RCV003976464 RCV003943081 RCV003935995 RCV003926257
Uterine corpus endometrial carcinoma	Benign	rs7220814	RCV005935148

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	18830724
Dementia	Associate	31836585
Hodgkin Disease	Associate	36334623
Lymphoma	Associate	37847650
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	34382383
Neoplasms	Associate	34382383, 37776857
Pancreatic Neoplasms	Associate	21536687

TNK1 (tyrosine kinase non receptor 1)