MARCO (macrophage receptor with collagenous structure)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8685
Gene name Gene Name - the full gene name approved by the HGNC.
Macrophage receptor with collagenous structure
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MARCO
Synonyms (NCBI Gene) Gene synonyms aliases
SCARA2, SR-A6
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q14.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger rec
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding ISS
GO:0001664 Function G protein-coupled receptor binding IBA 21873635
GO:0001664 Function G protein-coupled receptor binding IPI 20141570
GO:0001664 Function G protein-coupled receptor binding ISS
GO:0001934 Process Positive regulation of protein phosphorylation ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604870 6895 ENSG00000019169
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UEW3
Protein name Macrophage receptor MARCO (Macrophage receptor with collagenous structure) (Scavenger receptor class A member 2)
Protein function Pattern recognition receptor (PRR) which binds Gram-positive and Gram-negative bacteria (PubMed:9468508). Also plays a role in binding of unopsonized particles by alveolar macrophages (By similarity). Binds to the secretoglobin SCGB3A2 (PubMed:1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01391 Collagen 140 → 205 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 361 → 423 Collagen triple helix repeat (20 copies) Repeat
PF00530 SRCR 427 → 519 Scavenger receptor cysteine-rich domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in alveolar macrophages (at protein level). Detected in macrophages from various tissues including thymus, kidney, Kupffer cells of liver, and spleen (PubMed:9468508). {ECO:0000269|PubMed:10224290, ECO:0000269|PubMed:9468508}
Sequence 
MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGA
GLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
TWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAK
GAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPK
GETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQ
GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQ
GRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN
SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQ
IWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Sequence length 520
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Phagosome   Scavenging by Class A Receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Non-obstructive azoospermia Non-obstructive azoospermia rs587777872, rs879253743, rs1600840291, rs1600877766, rs753462162, rs1588618614, rs1602684496, rs377712900 22541561
Show/Hide Text Mining Associations (27)
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 20141570
Arthritis Associate 11315932
Arthritis Juvenile Stimulate 27706807
Arthritis Reactive Stimulate 11315932
Arthritis Rheumatoid Associate 11315932, 36911710
Breast Neoplasms Stimulate 37212598
Carcinoma Non Small Cell Lung Associate 34011400
Cholangiocarcinoma Associate 39471066
Depressive Disorder Major Associate 36911710
Diabetes Mellitus Associate 36066992