MARCO (macrophage receptor with collagenous structure)

Gene

• Entrez ID: 8685
• Gene name: Macrophage receptor with collagenous structure
• Gene symbol: MARCO
• Synonyms (NCBI Gene): SCARA2, SR-A6
• Chromosome: 2
• Chromosome location: 2q14.2
• Summary: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger rec

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IEA
GO:0001540	Function	Amyloid-beta binding	ISS
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	IPI	20141570
GO:0001664	Function	G protein-coupled receptor binding	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10331948
GO:0005581	Component	Collagen trimer	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	9468508
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9468508
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0016020	Component	Membrane	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0038024	Function	Cargo receptor activity	IEA
GO:0038024	Function	Cargo receptor activity	ISS
GO:0038187	Function	Pattern recognition receptor activity	TAS	10331948
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0097242	Process	Amyloid-beta clearance	IEA
GO:0097242	Process	Amyloid-beta clearance	ISS

Other IDs

• MIM: 604870
• HGNC: 6895
• e!Ensembl: ENSG00000019169

Protein

• UniProt ID: Q9UEW3
• Protein name: Macrophage receptor MARCO (Macrophage receptor with collagenous structure) (Scavenger receptor class A member 2)
• Protein function: Pattern recognition receptor (PRR) which binds Gram-positive and Gram-negative bacteria (PubMed:9468508). Also plays a role in binding of unopsonized particles by alveolar macrophages (By similarity). Binds to the secretoglobin SCGB3A2 (PubMed:1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	140 → 205	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	361 → 423	Collagen triple helix repeat (20 copies)	Repeat
  PF00530	SRCR	427 → 519	Scavenger receptor cysteine-rich domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in alveolar macrophages (at protein level). Detected in macrophages from various tissues including thymus, kidney, Kupffer cells of liver, and spleen (PubMed:9468508). {ECO:0000269|PubMed:10224290, ECO:0000269|PubMed:9468508}
• Sequence:

  MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGA
  GLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
  TWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAK
  GAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPK
  GETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQ
  GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQ
  GRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN
  SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQ
  IWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV

• Sequence length: 520

Pathways

KEGG:

Phagosome

Reactome:

Scavenging by Class A Receptors

<