Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	868
Gene name Gene Name - the full gene name approved by the HGNC.	Cbl proto-oncogene B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CBLB
Synonyms (NCBI Gene) Gene synonyms aliases	ADMIO3, Cbl-b, Nbla00127, RNF56
Disease Acronyms (UniProt) Disease acronyms from UniProt database	ADMIO3
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an E3 ubiquitin-protein ligase which promotes proteosome-mediated protein degradation by transferring ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate. The encoded protein is involved in the regulation of immune response

Show/Hide all(122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT719554	hsa-miR-151a-5p	HITS-CLIP	19536157
MIRT719553	hsa-miR-151b	HITS-CLIP	19536157
MIRT719552	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT719551	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT719550	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT719549	hsa-miR-4635	HITS-CLIP	19536157
MIRT719548	hsa-miR-3150b-3p	HITS-CLIP	19536157
MIRT719547	hsa-miR-4784	HITS-CLIP	19536157
MIRT719546	hsa-miR-765	HITS-CLIP	19536157
MIRT719545	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT719544	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT719543	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT659794	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT659793	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT659792	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT659791	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT659789	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT659790	hsa-miR-3977	HITS-CLIP	23824327
MIRT659788	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT731259	hsa-miR-891b	Luciferase reporter assay, qRT-PCR, Western blot	27494897
MIRT731259	hsa-miR-891b	Luciferase reporter assay, qRT-PCR, Western blot	27494897
MIRT736560	hsa-miR-181a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32612385
MIRT719554	hsa-miR-151a-5p	HITS-CLIP	19536157
MIRT719553	hsa-miR-151b	HITS-CLIP	19536157
MIRT719552	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT719551	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT719550	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT719549	hsa-miR-4635	HITS-CLIP	19536157
MIRT719548	hsa-miR-3150b-3p	HITS-CLIP	19536157
MIRT719547	hsa-miR-4784	HITS-CLIP	19536157
MIRT719546	hsa-miR-765	HITS-CLIP	19536157
MIRT719545	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT719544	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT719543	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT659794	hsa-miR-4762-5p	HITS-CLIP	23824327
MIRT659793	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT659792	hsa-miR-516a-3p	HITS-CLIP	23824327
MIRT659791	hsa-miR-516b-3p	HITS-CLIP	23824327
MIRT659789	hsa-miR-7162-5p	HITS-CLIP	23824327
MIRT659790	hsa-miR-3977	HITS-CLIP	23824327
MIRT659788	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT1546209	hsa-miR-1253	CLIP-seq
MIRT1546210	hsa-miR-27a	CLIP-seq
MIRT1546211	hsa-miR-27b	CLIP-seq
MIRT1546212	hsa-miR-3121-5p	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT1546215	hsa-miR-513a-5p	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT1546218	hsa-miR-580	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT2193971	hsa-miR-1257	CLIP-seq
MIRT2193972	hsa-miR-1285	CLIP-seq
MIRT2193973	hsa-miR-223	CLIP-seq
MIRT2193974	hsa-miR-3187-5p	CLIP-seq
MIRT2193975	hsa-miR-3611	CLIP-seq
MIRT2193976	hsa-miR-3654	CLIP-seq
MIRT2193977	hsa-miR-3661	CLIP-seq
MIRT2193978	hsa-miR-4277	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT2193979	hsa-miR-4535	CLIP-seq
MIRT2193980	hsa-miR-4694-3p	CLIP-seq
MIRT2193981	hsa-miR-4697-3p	CLIP-seq
MIRT2193982	hsa-miR-4712-3p	CLIP-seq
MIRT2193983	hsa-miR-492	CLIP-seq
MIRT2193984	hsa-miR-539	CLIP-seq
MIRT2193985	hsa-miR-548c-3p	CLIP-seq
MIRT2193986	hsa-miR-581	CLIP-seq
MIRT2193987	hsa-miR-612	CLIP-seq
MIRT2193988	hsa-miR-631	CLIP-seq
MIRT2446252	hsa-miR-1323	CLIP-seq
MIRT2446253	hsa-miR-548ac	CLIP-seq
MIRT2446254	hsa-miR-548ae	CLIP-seq
MIRT2446255	hsa-miR-548aj	CLIP-seq
MIRT2446256	hsa-miR-548am	CLIP-seq
MIRT2446257	hsa-miR-548d-3p	CLIP-seq
MIRT2446258	hsa-miR-548o	CLIP-seq
MIRT2446259	hsa-miR-548x	CLIP-seq
MIRT2446260	hsa-miR-548z	CLIP-seq
MIRT1546210	hsa-miR-27a	CLIP-seq
MIRT1546211	hsa-miR-27b	CLIP-seq
MIRT2497313	hsa-miR-30a	CLIP-seq
MIRT2497314	hsa-miR-30b	CLIP-seq
MIRT2497315	hsa-miR-30c	CLIP-seq
MIRT2497316	hsa-miR-30d	CLIP-seq
MIRT2497317	hsa-miR-30e	CLIP-seq
MIRT2497318	hsa-miR-3607-3p	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT2497319	hsa-miR-4776-3p	CLIP-seq
MIRT1546215	hsa-miR-513a-5p	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT2497320	hsa-miR-548ag	CLIP-seq
MIRT2497321	hsa-miR-548ai	CLIP-seq
MIRT2497322	hsa-miR-548g	CLIP-seq
MIRT2497323	hsa-miR-624	CLIP-seq
MIRT2193973	hsa-miR-223	CLIP-seq
MIRT1546210	hsa-miR-27a	CLIP-seq
MIRT1546211	hsa-miR-27b	CLIP-seq
MIRT2497313	hsa-miR-30a	CLIP-seq
MIRT2497314	hsa-miR-30b	CLIP-seq
MIRT2497315	hsa-miR-30c	CLIP-seq
MIRT2497316	hsa-miR-30d	CLIP-seq
MIRT2497317	hsa-miR-30e	CLIP-seq
MIRT2497318	hsa-miR-3607-3p	CLIP-seq
MIRT1546213	hsa-miR-3973	CLIP-seq
MIRT1546214	hsa-miR-4422	CLIP-seq
MIRT2193981	hsa-miR-4697-3p	CLIP-seq
MIRT2497319	hsa-miR-4776-3p	CLIP-seq
MIRT1546215	hsa-miR-513a-5p	CLIP-seq
MIRT1546216	hsa-miR-520g	CLIP-seq
MIRT1546217	hsa-miR-520h	CLIP-seq
MIRT2497320	hsa-miR-548ag	CLIP-seq
MIRT2497321	hsa-miR-548ai	CLIP-seq
MIRT2497322	hsa-miR-548g	CLIP-seq
MIRT2497323	hsa-miR-624	CLIP-seq
MIRT2677462	hsa-miR-944	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0002669	Process	Positive regulation of T cell anergy	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	10022120, 12177062, 12577067, 16189514, 17020880, 17255943, 18680311, 19268472, 19380743, 20598684, 20936779, 21706016, 21900206, 23663663, 25218436, 25416956, 25814554, 26871637, 27107012, 28514442, 29237719, 29513927, 29997244, 31467278, 31515488, 31980649, 32296183, 32814053
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006607	Process	NLS-bearing protein import into nucleus	TAS	7784085
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	IBA	21873635
GO:0008270	Function	Zinc ion binding	TAS	7784085
GO:0016567	Process	Protein ubiquitination	IEA
GO:0017124	Function	SH3 domain binding	IBA	21873635
GO:0018193	Process	Peptidyl-amino acid modification	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA	21873635
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042110	Process	T cell activation	IEA
GO:0043087	Process	Regulation of GTPase activity	IEA
GO:0043393	Process	Regulation of protein binding	IEA
GO:0045121	Component	Membrane raft	IBA	21873635
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:2000583	Process	Regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS

MIM	HGNC	e!Ensembl
604491	1542	ENSG00000114423

Protein

UniProt ID

Q13191

Protein name

E3 ubiquitin-protein ligase CBL-B (EC 2.3.2.27) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) (RING-type E3 ubiquitin transferase CBL-B) (SH3-binding protein CBL-B) (Signal transduction protein CBL-B)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome. Negatively regulates TCR (T-cell receptor), BCR (B-cell

PDB

2AK5 , 2BZ8 , 2DO6 , 2J6F , 2JNH , 2LDR , 2OOA , 2OOB , 3PFV , 3VGO , 3ZNI , 8GCY , 8QNG , 8QNH , 8QNI , 8QTG , 8QTH , 8QTJ , 8QTK , 8VW4 , 8VW5 , 9FQH , 9FQI , 9FQJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02262	Cbl_N	41 → 167	CBL proto-oncogene N-terminal domain 1	Domain
PF02761	Cbl_N2	171 → 254	CBL proto-oncogene N-terminus, EF hand-like domain	Domain
PF02762	Cbl_N3	256 → 341	CBL proto-oncogene N-terminus, SH2-like domain	Domain
PF14447	Prok-RING_4	373 → 426		Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, heart, lung, kidney, spleen, ovary and testis, as well as fetal brain and liver and hematopoietic cell lines, but not in adult brain, liver, pancreas, salivary gland, or skeletal muscle. Present in lymphocytes (a

Sequence

MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL

Sequence length

982

Interactions

View interactions

	KEGG		Reactome
	ErbB signaling pathway Ubiquitin mediated proteolysis Endocytosis C-type lectin receptor signaling pathway T cell receptor signaling pathway Insulin signaling pathway Measles		Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)	30595370
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	28445677, 20453840

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Multisystem Autoimmune Disease	autoimmune disease, multisystem, infantile-onset, 3	GenCC
Multiple Sclerosis	Multiple Sclerosis	GWAS
Dementia	Dementia	GWAS
Urticaria	Urticaria	GWAS
Ischemic Stroke	Ischemic Stroke	GWAS

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	29384143
Adenocarcinoma of Lung	Associate	29384143
Alzheimer Disease	Associate	34217363
Anemia Aplastic	Associate	27036622
Asthma	Associate	23046476, 26112603
Atrophy	Associate	35204692
Autoimmune Diseases	Associate	22158902, 31659016
Breast Diseases	Associate	32365829
Breast Neoplasms	Associate	32365829
Carcinogenesis	Associate	27039262
Carcinoma Intraductal Noninfiltrating	Associate	38615592
Carcinoma Non Small Cell Lung	Associate	23586056, 29364514, 29384143
Carcinoma Squamous Cell	Associate	29384143
Diabetes Gestational	Associate	35046894
Diabetes Mellitus Type 1	Associate	31659016, 34006268
Drug Related Side Effects and Adverse Reactions	Associate	36361619
Encephalomyelitis Autoimmune Experimental	Associate	20453840
Gallbladder Neoplasms	Associate	26395180
Glioma	Associate	25691332
Hemangioma capillary infantile	Associate	36181115
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	38615592
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21346257
Leukemia Myeloid Acute	Associate	17475912, 19901108, 36361619, 9614102
Lung Neoplasms	Associate	29384143
Lupus Erythematosus Systemic	Associate	23280105, 28940360
Lymphatic Metastasis	Associate	20038312, 24885194
Mental Retardation X Linked 92	Associate	36361619
Methylmalonic acidemia	Associate	20556797, 20696242, 22614770, 26420839, 29996803, 33453710
Methylmalonic aciduria cblB type	Associate	15292234
Multiple Sclerosis	Associate	20453840, 23039885, 25261476
Multiple Sclerosis Relapsing Remitting	Inhibit	25261476
Muscular Atrophy	Associate	35204692
Myelodysplastic Myeloproliferative Diseases	Associate	21346257
Neoplasm Metastasis	Associate	30429477
Neoplasms	Associate	22158902, 26395180, 33419766, 36090975
Neoplasms	Inhibit	24351824
Nephritis Interstitial	Associate	26420839
Personality Disorders	Associate	30402490
Purpura Thrombocytopenic Idiopathic	Inhibit	38184203
Respiratory Sounds	Associate	26112603
Sarcoidosis	Associate	22984568
Sezary Syndrome	Associate	27039262
Stomach Neoplasms	Associate	20038312, 24351824, 24885194, 27685907, 28972304, 37306927
Tarlov Cysts	Associate	26395180
Waldenstrom Macroglobulinemia	Associate	30402490
Xanthogranulomatous cholecystitis	Associate	26395180

CBLB (Cbl proto-oncogene B)