Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8668
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 3 subunit I
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF3I
Synonyms (NCBI Gene) Gene synonyms aliases
EIF3S2, PRO2242, TRIP-1, TRIP1, eIF3-beta, eIF3-p36
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p35.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016316 hsa-miR-193b-3p Proteomics 21512034
MIRT049001 hsa-miR-92a-3p CLASH 23622248
MIRT046640 hsa-miR-222-3p CLASH 23622248
MIRT045793 hsa-miR-191-5p CLASH 23622248
MIRT016316 hsa-miR-193b-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001732 Process Formation of cytoplasmic translation initiation complex IEA
GO:0001732 Process Formation of cytoplasmic translation initiation complex NAS 16920360
GO:0002183 Process Cytoplasmic translational initiation IBA
GO:0002183 Process Cytoplasmic translational initiation IEA
GO:0003723 Function RNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603911 3272 ENSG00000084623
Protein
UniProt ID Q13347
Protein name Eukaryotic translation initiation factor 3 subunit I (eIF3i) (Eukaryotic translation initiation factor 3 subunit 2) (TGF-beta receptor-interacting protein 1) (TRIP-1) (eIF-3-beta) (eIF3 p36)
Protein function Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40
PDB 6YBT , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8XXN , 9BLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 3 37 WD domain, G-beta repeat Repeat
PF00400 WD40 42 80 WD domain, G-beta repeat Repeat
PF00400 WD40 275 312 WD domain, G-beta repeat Repeat
Sequence
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWD
CETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIH
YFDPQYFEFEFEA
Sequence length 325
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
<