Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8666
Gene name Gene Name - the full gene name approved by the HGNC.
Eukaryotic translation initiation factor 3 subunit G
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EIF3G
Synonyms (NCBI Gene) Gene synonyms aliases
EIF3-P42, EIF3S4, eIF3-delta, eIF3-p44
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a core subunit of the eukaryotic translation initiation factor 3 (eIF3) complex, which is required for initiation of protein translation. An N-terminal caspase cleavage product of the encoded protein may stimulate degradation of DNA. A m
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020496 hsa-miR-155-5p Proteomics 18668040
MIRT049415 hsa-miR-92a-3p CLASH 23622248
MIRT045194 hsa-miR-186-5p CLASH 23622248
MIRT039322 hsa-miR-425-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001732 Process Formation of cytoplasmic translation initiation complex IEA
GO:0001732 Process Formation of cytoplasmic translation initiation complex NAS 16920360
GO:0002183 Process Cytoplasmic translational initiation IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603913 3274 ENSG00000130811
Protein
UniProt ID O75821
Protein name Eukaryotic translation initiation factor 3 subunit G (eIF3g) (Eukaryotic translation initiation factor 3 RNA-binding subunit) (eIF-3 RNA-binding subunit) (Eukaryotic translation initiation factor 3 subunit 4) (eIF-3-delta) (eIF3 p42) (eIF3 p44)
Protein function RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates
PDB 2CQ0 , 2MJC , 5K0Y , 6YBS , 6ZMW , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8XXM , 8XXN , 9BLN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12353 eIF3g 56 175 Eukaryotic translation initiation factor 3 subunit G Family
PF00076 RRM_1 241 308 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence
MPTGDFDSKPSWADQVEEEGEDDKCVTSELLKGIPLATGDTSPEPELLPGAPLPPPKEVI
NGNIKTVTEYKIDEDGKKFKIVRTFRIETRKASKAVARRKNWKKFGNSEFDPPGPNVATT
TVSDDVSMTFITSKEDLNCQEEEDPMNKLKGQKIVSCRICKGDHWTTRCPYKDTL
GPMQK
ELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNAT
IRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGV
SGFGYDHL
ILNVEWAKPSTN
Sequence length 320
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    L13a-mediated translational silencing of Ceruloplasmin expression
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
<