Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8645
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium two pore domain channel subfamily K member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNK5
Synonyms (NCBI Gene) Gene synonyms aliases
K2p5.1, KCNK5b, TASK-2, TASK2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is hi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017258 hsa-miR-335-5p Microarray 18185580
MIRT722776 hsa-miR-4793-5p HITS-CLIP 19536157
MIRT722775 hsa-miR-6515-3p HITS-CLIP 19536157
MIRT722774 hsa-miR-1236-3p HITS-CLIP 19536157
MIRT722773 hsa-miR-29b-1-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005249 Function Voltage-gated potassium channel activity IEA
GO:0005267 Function Potassium channel activity IDA 9812978
GO:0005267 Function Potassium channel activity IEA
GO:0005267 Function Potassium channel activity ISS
GO:0005515 Function Protein binding IPI 32296183, 36063992
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603493 6280 ENSG00000164626
Protein
UniProt ID O95279
Protein name Potassium channel subfamily K member 5 (Acid-sensitive potassium channel protein TASK-2) (TWIK-related acid-sensitive K(+) channel 2)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 60 138 Ion channel Family
PF07885 Ion_trans_2 160 251 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: Abundant expression in kidney, also detected in liver, placenta and small intestine. In the kidney, expression is restricted to the distal tubules and collecting ducts (PubMed:9812978). Not expressed in proximal tubules or glomeruli (P
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFG
GRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVE
VHKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKNRVPTLEEVSQ
TLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI
TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELS
VPYEQLMNEYNKANSPKGT
Sequence length 499
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Taste transduction
Protein digestion and absorption
  Phase 4 - resting membrane potential
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Diabetes Hypertension in type 2 diabetes, Type 2 diabetes N/A N/A GWAS
Eating Disorders Eating disorders N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alkalosis Associate 36063992
Arthritis Rheumatoid Associate 21314928, 35413058
Balkan Nephropathy Associate 24949484, 26914156
Breast Neoplasms Associate 21680658
Depressive Disorder Major Associate 29995844
Intracranial Aneurysm Associate 37884687
Leukemia Myelogenous Chronic BCR ABL Positive Associate 23651669
Migraine Disorders Associate 28957430, 29995844, 33762637, 37884687
Migraine without Aura Associate 33762637
Multiple Sclerosis Associate 26909737