Gene Gene information from NCBI Gene database.
Entrez ID 8645
Gene name Potassium two pore domain channel subfamily K member 5
Gene symbol KCNK5
Synonyms (NCBI Gene)
K2p5.1KCNK5bTASK-2TASK2
Chromosome 6
Chromosome location 6p21.2
Summary This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is hi
miRNA miRNA information provided by mirtarbase database.
510
miRTarBase ID miRNA Experiments Reference
MIRT017258 hsa-miR-335-5p Microarray 18185580
MIRT722776 hsa-miR-4793-5p HITS-CLIP 19536157
MIRT722775 hsa-miR-6515-3p HITS-CLIP 19536157
MIRT722774 hsa-miR-1236-3p HITS-CLIP 19536157
MIRT722773 hsa-miR-29b-1-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0005249 Function Voltage-gated potassium channel activity IEA
GO:0005267 Function Potassium channel activity IDA 9812978
GO:0005267 Function Potassium channel activity IEA
GO:0005267 Function Potassium channel activity ISS
GO:0005515 Function Protein binding IPI 32296183, 36063992
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603493 6280 ENSG00000164626
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95279
Protein name Potassium channel subfamily K member 5 (Acid-sensitive potassium channel protein TASK-2) (TWIK-related acid-sensitive K(+) channel 2)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 60 138 Ion channel Family
PF07885 Ion_trans_2 160 251 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: Abundant expression in kidney, also detected in liver, placenta and small intestine. In the kidney, expression is restricted to the distal tubules and collecting ducts (PubMed:9812978). Not expressed in proximal tubules or glomeruli (P
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFG
GRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVE
VHKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKNRVPTLEEVSQ
TLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI
TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSESTFTSTESELS
VPYEQLMNEYNKANSPKGT
Sequence length 499
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Taste transduction
Protein digestion and absorption
  Phase 4 - resting membrane potential
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
KCNK5-related disorder Likely benign rs41273124, rs201768235 RCV003933922
RCV003969762
Thyroid cancer, nonmedullary, 1 Uncertain significance rs751933589 RCV005929193
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alkalosis Associate 36063992
Arthritis Rheumatoid Associate 21314928, 35413058
Balkan Nephropathy Associate 24949484, 26914156
Breast Neoplasms Associate 21680658
Depressive Disorder Major Associate 29995844
Intracranial Aneurysm Associate 37884687
Leukemia Myelogenous Chronic BCR ABL Positive Associate 23651669
Migraine Disorders Associate 28957430, 29995844, 33762637, 37884687
Migraine without Aura Associate 33762637
Multiple Sclerosis Associate 26909737