AKR1C3 (aldo-keto reductase family 1 member C3)

Gene

• Entrez ID: 8644
• Gene name: Aldo-keto reductase family 1 member C3
• Gene symbol: AKR1C3
• Synonyms (NCBI Gene): DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS
• Chromosome: 10
• Chromosome location: 10p15.1
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020887	hsa-miR-155-5p	Proteomics	18668040
MIRT027720	hsa-miR-98-5p	Microarray	19088304
MIRT776290	hsa-miR-1207-3p	CLIP-seq
MIRT776291	hsa-miR-184	CLIP-seq
MIRT776292	hsa-miR-190	CLIP-seq
MIRT776293	hsa-miR-190b	CLIP-seq
MIRT776294	hsa-miR-198	CLIP-seq
MIRT776295	hsa-miR-3136-5p	CLIP-seq
MIRT776296	hsa-miR-3689a-5p	CLIP-seq
MIRT776297	hsa-miR-3689b	CLIP-seq
MIRT776298	hsa-miR-3689e	CLIP-seq
MIRT776299	hsa-miR-3689f	CLIP-seq
MIRT776300	hsa-miR-4439	CLIP-seq
MIRT776301	hsa-miR-4513	CLIP-seq
MIRT776302	hsa-miR-4700-3p	CLIP-seq
MIRT776303	hsa-miR-4703-3p	CLIP-seq
MIRT776304	hsa-miR-512-5p	CLIP-seq
MIRT776305	hsa-miR-562	CLIP-seq
MIRT776306	hsa-miR-943	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Repression	22971343

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	TAS
GO:0001758	Function	Retinal dehydrogenase activity	IDA	21851338
GO:0004032	Function	Alditol:NADP+ 1-oxidoreductase activity	IBA	21873635
GO:0004032	Function	Alditol:NADP+ 1-oxidoreductase activity	IDA	21232532
GO:0004033	Function	Aldo-keto reductase (NADP) activity	TAS	9792917
GO:0004303	Function	Estradiol 17-beta-dehydrogenase activity	IEA
GO:0004745	Function	Retinol dehydrogenase activity	IDA	21851338
GO:0005634	Component	Nucleus	IDA	18574251
GO:0005737	Component	Cytoplasm	IDA	18574251, 19336506, 19942269, 22170488
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006693	Process	Prostaglandin metabolic process	IBA	21873635
GO:0006693	Process	Prostaglandin metabolic process	IEP	20036328
GO:0006693	Process	Prostaglandin metabolic process	TAS	9792917
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	18508192
GO:0007584	Process	Response to nutrient	IEP	19007764
GO:0008202	Process	Steroid metabolic process	IBA	21873635
GO:0008202	Process	Steroid metabolic process	IEP	20036328
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	18508192, 20036328
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21851338
GO:0008584	Process	Male gonad development	IEP	19942269
GO:0009267	Process	Cellular response to starvation	IEP	18641923
GO:0010942	Process	Positive regulation of cell death	IDA	21787718
GO:0016229	Function	Steroid dehydrogenase activity	IBA	21873635
GO:0016488	Process	Farnesol catabolic process	IDA	21187079
GO:0016655	Function	Oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	19442656, 20837989
GO:0018636	Function	Phenanthrene 9,10-monooxygenase activity	IDA	21851338
GO:0019371	Process	Cyclooxygenase pathway	TAS
GO:0030216	Process	Keratinocyte differentiation	IEP	22170488
GO:0032052	Function	Bile acid binding	IBA	21873635
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	21787718
GO:0035410	Function	Dihydrotestosterone 17-beta-dehydrogenase activity	IDA	16983398
GO:0036130	Function	Prostaglandin H2 endoperoxidase reductase activity	TAS
GO:0036131	Function	Prostaglandin D2 11-ketoreductase activity	TAS
GO:0042448	Process	Progesterone metabolic process	IBA	21873635
GO:0042448	Process	Progesterone metabolic process	IDA	21232532
GO:0042572	Process	Retinol metabolic process	IEA
GO:0042574	Process	Retinal metabolic process	IDA	21851338
GO:0043170	Process	Macromolecule metabolic process	IEP	18641923
GO:0044597	Process	Daunorubicin metabolic process	IBA	21873635
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IBA	21873635
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0045550	Function	Geranylgeranyl reductase activity	IDA	21187079
GO:0045703	Function	Ketoreductase activity	IDA	19487289
GO:0047017	Function	Prostaglandin-F synthase activity	IEA
GO:0047020	Function	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	IDA	22170488
GO:0047023	Function	Androsterone dehydrogenase activity	IBA	21873635
GO:0047023	Function	Androsterone dehydrogenase activity	IDA	16983398
GO:0047024	Function	5alpha-androstane-3beta,17beta-diol dehydrogenase activity	IEA
GO:0047035	Function	Testosterone dehydrogenase (NAD+) activity	IEA
GO:0047044	Function	Androstan-3-alpha,17-beta-diol dehydrogenase activity	IEA
GO:0047045	Function	Testosterone 17-beta-dehydrogenase (NADP+) activity	IEA
GO:0047086	Function	Ketosteroid monooxygenase activity	IBA	21873635
GO:0047086	Function	Ketosteroid monooxygenase activity	IDA	21232532
GO:0047787	Function	Delta4-3-oxosteroid 5beta-reductase activity	IDA	16983398
GO:0048385	Process	Regulation of retinoic acid receptor signaling pathway	IDA	21851338
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	18508192
GO:0052650	Function	NADP-retinol dehydrogenase activity	TAS
GO:0061370	Process	Testosterone biosynthetic process	IMP	16983398
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070293	Process	Renal absorption	NAS	16157291
GO:0071276	Process	Cellular response to cadmium ion	IDA	21787718
GO:0071277	Process	Cellular response to calcium ion	IDA	22170488
GO:0071379	Process	Cellular response to prostaglandin stimulus	IDA	22170488
GO:0071384	Process	Cellular response to corticosteroid stimulus	IDA	19336506
GO:0071395	Process	Cellular response to jasmonic acid stimulus	IDA	19487289
GO:0071799	Process	Cellular response to prostaglandin D stimulus	IDA	18508192
GO:1900053	Process	Negative regulation of retinoic acid biosynthetic process	IDA	21851338
GO:2000224	Process	Regulation of testosterone biosynthetic process	IMP	19336506
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	19442656
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	19442656

Other IDs

• MIM: 603966
• HGNC: 386
• e!Ensembl: ENSG00000196139

Protein

• UniProt ID: P42330
• Protein name: Aldo-keto reductase family 1 member C3 (EC 1.1.1.-) (EC 1.1.1.210) (EC 1.1.1.53) (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase type 5) (17-beta-HSD 5) (3-alpha-HSD type II, brain) (3-alpha-hydroxysteroid dehydrogenase type 2) (3-alpha-HSD type 2) (E
• Protein function: Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Acts as a NAD(P)(H)-dependent 3-, 17- and 20-ketosteroid reductase on the steroid nucleus and side chain and regulates the me
• PDB: 1RY0, 1RY8, 1S1P, 1S1R, 1S2A, 1S2C, 1XF0, 1ZQ5, 2F38, 2FGB, 3R43, 3R58, 3R6I, 3R7M, 3R8G, 3R8H, 3R94, 3UFY, 3UG8, 3UGR, 3UWE, 4DBS, 4DBU, 4DBW, 4DZ5, 4FA3, 4FAL, 4FAM, 4H7C, 4HMN, 4WDT, 4WDU, 4WDW, 4WDX, 4WRH, 4XVD, 4XVE, 4YVV, 4YVX, 4ZFC, 5HNT, 5HNU, 6A7B, 6F2U, 6F78, 6GXK, 7C7F, 7C7G, 7C7H, 7WQM, 7WQR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	18 → 301	Aldo/keto reductase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. High expression in prostate and mammary gland. In the prostate, higher levels
• Sequence:

  MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
  VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
  SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
  GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
  LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
  RNLHYFNSDSFASHPNYPYSDEY

• Sequence length: 323

Pathways

KEGG:

Steroid hormone biosynthesis
Arachidonic acid metabolism
Folate biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Chemical carcinogenesis - reactive oxygen species

Reactome:

Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
Synthesis of bile acids and bile salts via 24-hydroxycholesterol
Synthesis of bile acids and bile salts via 27-hydroxycholesterol
Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
RA biosynthesis pathway
Retinoid metabolism and transport

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Endometrial carcinoma	Endometrial Carcinoma	rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077, rs587779206, rs63750439, rs63751405, rs63750741, rs63750854, rs63750909, rs587779212, rs63749874, rs267608076, rs587779220, rs63750735, rs267608082, rs587779227, rs267608068, rs63750075, rs587779232, rs267608058, rs63751127, rs63750138, rs267608065, rs63751017, rs587779246, rs63750111, rs63750563, rs267608073, rs63751407, rs63749999, rs267608042, rs63750833, rs587779255, rs587779256, rs267608078, rs267608092, rs587779263, rs267608098, rs587779267, rs63750194, rs63751327, rs63751328, rs587779284, rs63749942, rs63751058, rs267608114, rs267608118, rs63751319, rs267608128, rs1553333594, rs267608126, rs63750767, rs267608120, rs267608121, rs267608122, rs63750342, rs63749873, rs587779318, rs63750019, rs63749980, rs267608048, rs1553412283, rs146816935, rs63750855, rs63751711, rs267607789, rs587779094, rs63750224, rs267607972, rs63750084, rs587779185, rs587778617, rs398123231, rs398123232, rs398123318, rs587780021, rs63750119, rs267608064, rs587781490, rs587781558, rs587781691, rs63749821, rs587782111, rs587782326, rs587782704, rs587779264, rs587779333, rs587782712, rs587783056, rs730881825, rs730881827, rs730881829, rs730881830, rs786202193, rs587782281, rs786202848, rs786201049, rs750528093, rs786202108, rs267608083, rs786201050, rs786203924, rs587781544, rs786201084, rs1553333738, rs863224829, rs863225398, rs863225409, rs863225412, rs864622041, rs869312769, rs869312770, rs63751077, rs876661205, rs876661025, rs63749919, rs876661073, rs876661222, rs267608041, rs878853702, rs751326348, rs866260675, rs886039666, rs886044911, rs1057517552, rs1057517764, rs1057517763, rs121909224, rs1057520605, rs1060502885, rs1060502918, rs1060502932, rs587779215, rs1060502937, rs1060502886, rs1060502875, rs1060502881, rs267607939, rs1023534466, rs1064793600, rs1064795256, rs1064795591, rs1064794055, rs1064794164, rs1553414010, rs1064793671, rs1064794302, rs1064793489, rs1064794384, rs1064793781, rs1553333500, rs760190301, rs1114167719, rs1114167776, rs1114167704, rs1114167748, rs1114167731, rs753796271, rs267608055, rs1114167746, rs1114167715, rs587782706, rs1114167750, rs1114167765, rs1114167747, rs786204048, rs1114167707, rs1114167767, rs1114167717, rs1114167783, rs1553412966, rs1553333598, rs587779297, rs1554294505, rs988423880, rs1554306353, rs1553408136, rs1553333321, rs1553408388, rs63749973, rs1553412064, rs1553412120, rs1553826166, rs1553413784, rs1553331242, rs1553414519, rs1564568660, rs1558392033, rs878853704, rs765763906, rs1558663559, rs1572720704, rs63750985, rs1572727440, rs587779253, rs1580538168, rs149350323, rs374133543, rs771721952, rs201033017, rs763478027, rs1475633334, rs1580553624, rs1580553669, rs578113271, rs757194485, rs539295465, rs778610412, rs758191157, rs1580597397, rs1580033751, rs751236312, rs376667075, rs1561486630, rs1561486632, rs777054839, rs1204002507, rs766672143, rs1580091499, rs1386063673, rs1450314617, rs1580027713, rs367544716, rs1488467945, rs1580053768, rs1580553607, rs1572720794, rs1572722039, rs1572723786, rs1572725235, rs1572728112, rs1175196087, rs1572741984, rs1580540688, rs1259647122, rs1580546793, rs1234762807, rs1580556516, rs1669245178, rs1669365820, rs756190979, rs371356175, rs766997264, rs1743353294, rs1379605717, rs770330684, rs1462955256, rs1744356274, rs1480047980, rs1744149615	16338060
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	19424620
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs193922650, rs193922685, rs193922687, rs751160202, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829	20882379
Ovarian cancer	Epithelial ovarian cancer	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393	31469419
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17507624, 18306354
Pseudohermaphroditism	Pseudohermaphroditism	rs119481075, rs119481076, rs119481077, rs201115371, rs144809928, rs750481017, rs372027264, rs773720185, rs1554694264, rs1554694678, rs747724352, rs767765046, rs149607031, rs1554705693	25304492

Unknown
Disease term	Disease name	Evidence	References	Source
Ambiguous genitalia	Ambiguous Genitalia		25304492	ClinVar
Endometriosis	Endometriosis		25446850, 21232532	ClinVar
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	21134280, 22670171, 24228104, 33371142
Adenocarcinoma of Lung	Associate	24228104
Adrenal Gland Neoplasms	Associate	19026713
Adrenal Insufficiency	Associate	33444228
Adrenocortical Adenoma	Inhibit	19026713
Adrenocortical Carcinoma	Associate	19026713
Alcoholism	Associate	21323680
Anemia	Associate	39596349
Arthropathy progressive pseudorheumatoid of childhood	Associate	31213128
Asthma	Associate	10622721
Asthma	Stimulate	36996663
Atrophy	Associate	34784541
Blood Platelet Disorders	Associate	23116553
Breast Neoplasms	Associate	15212687, 19010312, 19846565, 20036328, 21151387, 23116553, 34886806, 35739271, 39596349, 40489436
Calcinosis Cutis	Stimulate	22971343
Carcinogenesis	Associate	18339682, 36518267
Carcinogenesis	Inhibit	33493134
Carcinoma Basal Cell	Associate	21151387
Carcinoma Ductal Breast	Stimulate	19010312
Carcinoma Hepatocellular	Associate	14672942, 36451864, 38188684, 38287800
Carcinoma Hepatocellular	Stimulate	33493134
Carcinoma Non Small Cell Lung	Associate	22670171, 27385003, 28704416, 34268939
Carcinoma Ovarian Epithelial	Associate	31469419
Carcinoma Papillary	Associate	20126582
Carcinoma Renal Cell	Associate	20126582
Carcinoma Signet Ring Cell	Associate	34830394
Carcinoma Squamous Cell	Associate	22670171, 24228104, 24917395
Carcinoma Transitional Cell	Associate	34784541
Central Nervous System Neoplasms	Associate	21151387
Choriocarcinoma	Associate	25170291
Colorectal Neoplasms	Associate	24934327, 38287800
Crohn Disease	Associate	27140063
Death	Associate	19602686
Depressive Disorder	Associate	18552976
Dermatitis Atopic	Stimulate	22170488
Drug Hypersensitivity	Associate	10622721
Drug Related Side Effects and Adverse Reactions	Associate	26950072
Ehlers Danlos syndrome type 3	Associate	27518164
Endocrine System Diseases	Associate	36952646
Endometrial Hyperplasia	Inhibit	20661409
Endometrial Hyperplasia	Associate	21151387
Endometrial Neoplasms	Associate	21151387
Endometriosis	Associate	24035605
Esophageal Neoplasms	Associate	27385003, 39375680
Glioblastoma	Associate	19602686, 21649900
Glioma	Associate	18492260
Hematologic Diseases	Associate	23116553
Hereditary Angioedema Type III	Associate	19026713
Hereditary Angioedema Type III	Stimulate	20036328
Hyperaldosteronism	Associate	19026713, 21248073
Hyperandrogenism	Associate	16263811, 30975191, 36799021
Hypospadias	Associate	24986825
Inflammation	Associate	19010312, 22170488
Intervertebral Disc Degeneration	Associate	38007425
Kidney Neoplasms	Associate	20126582
Leukemia	Associate	18339682
Leukemia Myeloid Acute	Associate	26429394
Leukopenia	Associate	39596349
Lymphatic Metastasis	Associate	24934327
Lymphoma Non Hodgkin	Associate	18632753
Medulloblastoma	Associate	21151387
Meningioma	Associate	21151387
Metabolic Syndrome	Inhibit	18641923
Mitochondrial Diseases	Associate	36451864
Multiple Myeloma	Associate	40156642
Myocardial Infarction	Associate	33354250
Neoplasm Metastasis	Associate	24244276
Neoplasm Residual	Associate	33755225
Neoplasms	Associate	16838325, 19026713, 20661409, 21134280, 25526449, 26950072, 27385003, 27485119, 31376206, 31469419, 33493134, 39375680
Neoplasms	Inhibit	21151387
Neoplasms	Stimulate	24917395, 38188684
Neoplasms Adipose Tissue	Associate	18641923
Neuroendocrine Tumors	Associate	24228104
Obesity	Associate	18641923
Ovarian Diseases	Associate	30975191
Ovarian Neoplasms	Associate	31469419, 32590918
Personality Disorders	Associate	21134280
Polycystic Ovary Syndrome	Associate	16263811, 17940109, 18692800, 22329763, 28645211, 30975191, 36799021
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	36952646
Prostatic Neoplasms	Associate	18632753, 21134280, 23196782, 23258647, 23359804, 25754347, 26429394, 27385003, 29920533, 31125365, 32125151, 32430485, 36067250, 36596844, 36901944, 37772993
Prostatic Neoplasms	Stimulate	31980029
Prostatic Neoplasms Castration Resistant	Stimulate	21365123, 22507964, 23196782, 29936123, 32125151
Prostatic Neoplasms Castration Resistant	Associate	24244276, 28771887, 31376206, 36067250, 36596844, 36901944
Prostatitis	Associate	21151387, 26429394
Psychological Distress	Associate	35916411
Pulmonary Disease Chronic Obstructive	Associate	36475041
Pyruvate Carboxylase Deficiency Disease	Associate	31213128
Radiation Injuries	Associate	34268939
Simpson Golabi Behmel syndrome	Associate	36799021
Skin Neoplasms	Associate	24917395
Squamous Cell Carcinoma of Head and Neck	Associate	14997212
Stomach Neoplasms	Associate	35974335
Teratoma	Associate	28190856
Teratoma Ovarian	Associate	28190856
Thyroid Neoplasms	Associate	35741758
Urea Cycle Disorders Inborn	Associate	25522430
Urinary Bladder Neoplasms	Associate	18632753, 21323680, 27085562
Uterine Diseases	Inhibit	20661409
Uterine Diseases	Associate	24035605
Virilism	Associate	32590918
Weight Loss	Inhibit	18641923
Wilms Tumor	Associate	20126582, 21151387