Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8611
Gene name Gene Name - the full gene name approved by the HGNC.	Phospholipid phosphatase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLPP1
Synonyms (NCBI Gene) Gene synonyms aliases	LLP1a, LPP1, PAP-2a, PAP2, PPAP2A
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme i

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000810	Function	Diacylglycerol diphosphate phosphatase activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	9705349
GO:0005901	Component	Caveola	ISS
GO:0006644	Process	Phospholipid metabolic process	IBA	21873635
GO:0006644	Process	Phospholipid metabolic process	IDA	9305923, 9705349, 15461590
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IDA	9705349
GO:0006672	Process	Ceramide metabolic process	IDA	9305923, 9705349
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007165	Process	Signal transduction	IMP	15461590
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	9468526
GO:0008195	Function	Phosphatidate phosphatase activity	IBA	21873635
GO:0008195	Function	Phosphatidate phosphatase activity	IDA	9305923, 9468526, 9705349
GO:0008195	Function	Phosphatidate phosphatase activity	NAS	9570154
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	9468526
GO:0016020	Component	Membrane	IDA	9305923, 9468526
GO:0016324	Component	Apical plasma membrane	IDA	14527693
GO:0019216	Process	Regulation of lipid metabolic process	NAS	9468526
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030518	Process	Intracellular steroid hormone receptor signaling pathway	TAS	9468526
GO:0030521	Process	Androgen receptor signaling pathway	NAS	9468526
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IDA	9705349
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	TAS
GO:0042577	Function	Lipid phosphatase activity	IBA	21873635
GO:0042577	Function	Lipid phosphatase activity	IDA	15461590, 16464866
GO:0045121	Component	Membrane raft	IDA	17005594
GO:0046839	Process	Phospholipid dephosphorylation	IBA	21873635
GO:0046839	Process	Phospholipid dephosphorylation	IDA	9305923, 9705349, 15461590, 16464866
GO:0046839	Process	Phospholipid dephosphorylation	TAS	9468526
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0106235	Function	Ceramide-1-phosphate phosphatase activity	IDA	9705349

MIM	HGNC	e!Ensembl
607124	9228	ENSG00000067113

Protein

UniProt ID

O14494

Protein name

Phospholipid phosphatase 1 (EC 3.1.3.-) (EC 3.1.3.106) (EC 3.1.3.4) (EC 3.6.1.75) (Lipid phosphate phosphohydrolase 1) (PAP2-alpha) (Phosphatidate phosphohydrolase type 2a) (Phosphatidic acid phosphatase 2a) (PAP-2a) (PAP2a)

Protein function

Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosp

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01569	PAP2	101 → 251	PAP2 superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest expression found in prostate (PubMed:9305923). Found to be down-regulated in colon adenocarcinomas (PubMed:9570154). {ECO:0000269|PubMed:9305923, ECO:0000269|PubMed:9570154}.; TISSUE SPECIFICITY: [Isoform

Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Sequence length

284

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism Ether lipid metabolism Sphingolipid metabolism Metabolic pathways Phospholipase D signaling pathway Fc gamma R-mediated phagocytosis Fat digestion and absorption Choline metabolism in cancer		Sphingolipid de novo biosynthesis

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	21364753
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	21926974

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	9468526
Carcinoma Hepatocellular	Associate	36936948

PLPP1 (phospholipid phosphatase 1)