Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways
Entrez ID	8611
Gene name	Phospholipid phosphatase 1
Gene symbol	PLPP1
Synonyms (NCBI Gene)	LLP1aLPP1PAP-2aPAP2PPAP2A
Chromosome	5
Chromosome location	5q11.2
Summary	The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme i

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000810	Function	Diacylglycerol diphosphate phosphatase activity	IEA
GO:0000810	Function	Diacylglycerol diphosphate phosphatase activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	9705349
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IBA
GO:0006644	Process	Phospholipid metabolic process	IDA	9305923, 9705349, 15461590
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IDA	9705349
GO:0006670	Process	Sphingosine metabolic process	IEA
GO:0006672	Process	Ceramide metabolic process	IDA	9305923, 9705349
GO:0006672	Process	Ceramide metabolic process	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	IMP	15461590
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	9468526
GO:0008195	Function	Phosphatidate phosphatase activity	IBA
GO:0008195	Function	Phosphatidate phosphatase activity	IDA	9305923, 9468526, 9705349
GO:0008195	Function	Phosphatidate phosphatase activity	IEA
GO:0008195	Function	Phosphatidate phosphatase activity	NAS	9570154
GO:0008285	Process	Negative regulation of cell population proliferation	NAS	9468526
GO:0016020	Component	Membrane	IDA	9305923, 9468526
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	14527693
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019216	Process	Regulation of lipid metabolic process	NAS	9468526
GO:0030149	Process	Sphingolipid catabolic process	TAS
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	TAS	9468526
GO:0030521	Process	Androgen receptor signaling pathway	NAS	9468526
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IDA	9705349
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	IEA
GO:0042392	Function	Sphingosine-1-phosphate phosphatase activity	TAS
GO:0042577	Function	Lipid phosphatase activity	IDA	15461590, 16464866
GO:0042577	Function	Lipid phosphatase activity	IEA
GO:0045121	Component	Membrane raft	IDA	17005594
GO:0045121	Component	Membrane raft	IEA
GO:0046839	Process	Phospholipid dephosphorylation	IBA
GO:0046839	Process	Phospholipid dephosphorylation	IDA	9305923, 9705349, 15461590, 16464866
GO:0046839	Process	Phospholipid dephosphorylation	IEA
GO:0046839	Process	Phospholipid dephosphorylation	TAS	9468526
GO:0052642	Function	Lysophosphatidic acid phosphatase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0106235	Function	Ceramide-1-phosphate phosphatase activity	IDA	9705349
GO:0106235	Function	Ceramide-1-phosphate phosphatase activity	IEA

MIM	HGNC	e!Ensembl
607124	9228	ENSG00000067113

O14494

Protein name

Phospholipid phosphatase 1 (EC 3.1.3.-) (EC 3.1.3.106) (EC 3.1.3.4) (EC 3.6.1.75) (Lipid phosphate phosphohydrolase 1) (PAP2-alpha) (Phosphatidate phosphohydrolase type 2a) (Phosphatidic acid phosphatase 2a) (PAP-2a) (PAP2a)

Protein function

Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosp

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01569	PAP2	101 → 251	PAP2 superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest expression found in prostate (PubMed:9305923). Found to be down-regulated in colon adenocarcinomas (PubMed:9570154). {ECO:0000269|PubMed:9305923, ECO:0000269|PubMed:9570154}.; TISSUE SPECIFICITY: [Isoform

Sequence

MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP

Sequence length

284

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Glycerophospholipid metabolism Ether lipid metabolism Sphingolipid metabolism Metabolic pathways Phospholipase D signaling pathway Fc gamma R-mediated phagocytosis Fat digestion and absorption Choline metabolism in cancer		Sphingolipid de novo biosynthesis

PLPP1 (phospholipid phosphatase 1)