LGR5 (leucine rich repeat containing G protein-coupled receptor 5)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8549
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing G protein-coupled receptor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LGR5
Synonyms (NCBI Gene) Gene synonyms aliases
FEX, GPR49, GPR67, GRP49, HG38
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt sig
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT023026 hsa-miR-124-3p Microarray 18668037
MIRT437872 hsa-miR-142-3p Luciferase reporter assay, Western blot 23619912
MIRT497857 hsa-miR-6793-3p PAR-CLIP 22291592
MIRT497856 hsa-miR-361-3p PAR-CLIP 22291592
MIRT497855 hsa-miR-526b-5p PAR-CLIP 22291592
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(2)
Transcription factor Regulation Reference
OLIG2 Unknown 23793848
TCF4 Unknown 21436631
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(25)
GO ID Ontology Definition Evidence Reference
GO:0001942 Process Hair follicle development IEA
GO:0004888 Function Transmembrane signaling receptor activity IDA 21693646, 22815884
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IDA 21693646, 22815884
GO:0004930 Function G protein-coupled receptor activity TAS 9642114
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606667 4504 ENSG00000139292
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID O75473
Protein name Leucine-rich repeat-containing G-protein coupled receptor 5 (G-protein coupled receptor 49) (G-protein coupled receptor 67) (G-protein coupled receptor HG38)
Protein function Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a stem cell marker of the intestinal epithelium and the hair follicle. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphoryl
PDB 4BSR , 4BSS , 4BST , 4BSU , 4KNG , 4UFR , 4UFS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 33 → 65 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 90 → 150 Leucine rich repeat Repeat
PF13855 LRR_8 328 → 386 Leucine rich repeat Repeat
PF13855 LRR_8 374 → 434 Leucine rich repeat Repeat
PF13855 LRR_8 399 → 454 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal muscle, placenta, spinal cord, and various region of brain. Expressed at the base of crypts in colonic and small mucosa stem cells. In premalignant cancer expression is not restricted to the cript base. Overexpres
Sequence 
MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST
LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCHVIGFLSIFASESSVFLLTLAAL
ERGFSVKYSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSKYGASPLCLPLPFGEP
STMGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILNC
PVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYV
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSS
VAFVPCL
Sequence length 907
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Wnt signaling pathway   Regulation of FZD by ubiquitination
<