PIR (pirin)

Gene

• Entrez ID: 8544
• Gene name: Pirin
• Gene symbol: PIR
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box tran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023859	hsa-miR-1-3p	Proteomics	18668040

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IMP	23716661
GO:0003712	Function	Transcription coregulator activity	TAS	9079676
GO:0005515	Function	Protein binding	IPI	10362352
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9079676
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9079676
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	20089166
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9079676
GO:0007586	Process	Digestion	TAS
GO:0008127	Function	Quercetin 2,3-dioxygenase activity	IBA
GO:0008127	Function	Quercetin 2,3-dioxygenase activity	IDA	15951572
GO:0008127	Function	Quercetin 2,3-dioxygenase activity	IEA
GO:0008127	Function	Quercetin 2,3-dioxygenase activity	TAS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IBA
GO:0030224	Process	Monocyte differentiation	IMP	20010624
GO:0046872	Function	Metal ion binding	IDA	20711196
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA

Other IDs

• MIM: 300931
• HGNC: 30048
• e!Ensembl: ENSG00000087842

Protein

• UniProt ID: O00625
• Protein name: Pirin (EC 1.13.11.24) (Probable quercetin 2,3-dioxygenase PIR) (Probable quercetinase)
• Protein function: Transcriptional coregulator of NF-kappa-B which facilitates binding of NF-kappa-B proteins to target kappa-B genes in a redox-state-dependent manner. May be required for efficient terminal myeloid maturation of hematopoietic cells. Has quercetin
• PDB: 1J1L, 3ACL, 4ERO, 4EWA, 4EWD, 4EWE, 4GUL, 4HLT, 5JCT, 6H1H, 6H1I, 6N0J, 6N0K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02678	Pirin	21 → 118	Pirin	Family
  PF05726	Pirin_C	171 → 277	Pirin C-terminal cupin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in a subset of melanomas. Detected at very low levels in most tissues (at protein level). Expressed in all tissues, with highest level of expression in heart and liver. {ECO:0000269|PubMed:20089166, ECO:0000269|PubMed:
• Sequence:

  MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
  FETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNL
  RSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGA
  KHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVL
  IAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN

• Sequence length: 290

Pathways

Reactome:

Digestion