Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	85414
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 45 member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC45A3
Synonyms (NCBI Gene) Gene synonyms aliases	IPCA-2, IPCA-6, IPCA-8, IPCA6, PCANAP2, PCANAP6, PCANAP8, PRST
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1

Show/Hide all(79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000798	hsa-miR-126-3p	Western blot, Luciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Western blot, Luciferase reporter assay	18193184
MIRT000797	hsa-miR-138-5p	Western blot, Luciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Western blot, Luciferase reporter assay	18193184
MIRT000798	hsa-miR-126-3p	Western blot, Luciferase reporter assay	18193184
MIRT000797	hsa-miR-138-5p	Western blot, Luciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Luciferase reporter assay	18193184
MIRT006716	hsa-miR-32-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22521588
MIRT000798	hsa-miR-126-3p	Reporter assay;Other	18193184
MIRT001820	hsa-miR-126-5p	Reporter assay;Other	18193184
MIRT000797	hsa-miR-138-5p	Reporter assay;Other	18193184
MIRT439597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT000798	hsa-miR-126-3p	Microarray, qRT-PCR	35816043
MIRT1364494	hsa-miR-137	CLIP-seq
MIRT1364495	hsa-miR-15a	CLIP-seq
MIRT1364496	hsa-miR-15b	CLIP-seq
MIRT1364497	hsa-miR-16	CLIP-seq
MIRT1364498	hsa-miR-195	CLIP-seq
MIRT1364499	hsa-miR-208a	CLIP-seq
MIRT1364500	hsa-miR-208b	CLIP-seq
MIRT1364501	hsa-miR-2110	CLIP-seq
MIRT1364502	hsa-miR-214	CLIP-seq
MIRT1364503	hsa-miR-25	CLIP-seq
MIRT1364504	hsa-miR-3147	CLIP-seq
MIRT1364505	hsa-miR-3150a-3p	CLIP-seq
MIRT1364506	hsa-miR-3162-3p	CLIP-seq
MIRT1364507	hsa-miR-32	CLIP-seq
MIRT1364508	hsa-miR-361-3p	CLIP-seq
MIRT1364509	hsa-miR-3619-5p	CLIP-seq
MIRT1364510	hsa-miR-363	CLIP-seq
MIRT1364511	hsa-miR-367	CLIP-seq
MIRT1364512	hsa-miR-424	CLIP-seq
MIRT1364513	hsa-miR-4291	CLIP-seq
MIRT1364514	hsa-miR-4425	CLIP-seq
MIRT1364515	hsa-miR-4450	CLIP-seq
MIRT1364516	hsa-miR-4713-3p	CLIP-seq
MIRT1364517	hsa-miR-497	CLIP-seq
MIRT1364518	hsa-miR-518a-5p	CLIP-seq
MIRT1364519	hsa-miR-527	CLIP-seq
MIRT1364520	hsa-miR-761	CLIP-seq
MIRT1364521	hsa-miR-885-3p	CLIP-seq
MIRT1364522	hsa-miR-922	CLIP-seq
MIRT1364523	hsa-miR-92a	CLIP-seq
MIRT1364524	hsa-miR-92b	CLIP-seq
MIRT1920917	hsa-miR-122	CLIP-seq
MIRT1920918	hsa-miR-3659	CLIP-seq
MIRT1920919	hsa-miR-4793-5p	CLIP-seq
MIRT1920917	hsa-miR-122	CLIP-seq
MIRT1920918	hsa-miR-3659	CLIP-seq
MIRT1920919	hsa-miR-4793-5p	CLIP-seq
MIRT2108167	hsa-miR-3128	CLIP-seq
MIRT2108168	hsa-miR-3185	CLIP-seq
MIRT2108169	hsa-miR-383	CLIP-seq
MIRT2108170	hsa-miR-4699-5p	CLIP-seq
MIRT2108171	hsa-miR-4720-5p	CLIP-seq
MIRT2108172	hsa-miR-4772-5p	CLIP-seq
MIRT2108173	hsa-miR-4799-3p	CLIP-seq
MIRT2331986	hsa-miR-1271	CLIP-seq
MIRT2331987	hsa-miR-182	CLIP-seq
MIRT2331988	hsa-miR-2355-5p	CLIP-seq
MIRT2331989	hsa-miR-323-3p	CLIP-seq
MIRT2331990	hsa-miR-4738-3p	CLIP-seq
MIRT1364521	hsa-miR-885-3p	CLIP-seq
MIRT2331991	hsa-miR-96	CLIP-seq
MIRT2440544	hsa-miR-3664-5p	CLIP-seq
MIRT2440545	hsa-miR-4528	CLIP-seq
MIRT2440546	hsa-miR-4714-5p	CLIP-seq
MIRT2440544	hsa-miR-3664-5p	CLIP-seq
MIRT2440545	hsa-miR-4528	CLIP-seq
MIRT2440546	hsa-miR-4714-5p	CLIP-seq
MIRT2459765	hsa-miR-1827	CLIP-seq
MIRT2459766	hsa-miR-3130-5p	CLIP-seq
MIRT2459767	hsa-miR-3649	CLIP-seq
MIRT2459768	hsa-miR-4290	CLIP-seq
MIRT2459769	hsa-miR-4316	CLIP-seq
MIRT2459770	hsa-miR-4482	CLIP-seq
MIRT2459771	hsa-miR-711	CLIP-seq
MIRT2459772	hsa-miR-940	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence
GO:0005886	Component	Plasma membrane	TAS
GO:0008506	Function	Sucrose:proton symporter activity	IBA
GO:0008506	Function	Sucrose:proton symporter activity	IEA
GO:0008506	Function	Sucrose:proton symporter activity	ISS
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0010907	Process	Positive regulation of glucose metabolic process	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	ISS
GO:0015293	Function	Symporter activity	IEA
GO:0015770	Process	Sucrose transport	IEA
GO:0015770	Process	Sucrose transport	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	ISS
GO:0048713	Process	Regulation of oligodendrocyte differentiation	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	ISS
GO:0051119	Function	Sugar transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605097	8642	ENSG00000158715

Protein

UniProt ID

Q96JT2

Protein name

Solute carrier family 45 member 3 (Prostate cancer-associated protein 6) (Prostein)

Protein function

Proton-associated sucrose transporter. May be able to transport also glucose and fructose.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	18 → 305	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Prostate specific. Expressed in all prostatic glandular cells. Expressed both in normal and cancerous prostates. {ECO:0000269|PubMed:11245466, ECO:0000269|PubMed:14997204}.

Sequence

MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH
CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA
AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG
ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA
RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
VVFDKSDLAKYSA

Sequence length

553

Interactions

View interactions

	KEGG		Reactome
	Transcriptional misregulation in cancer MicroRNAs in cancer		Cellular hexose transport

SLC45A3 (solute carrier family 45 member 3)