Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	85414
Gene name	Solute carrier family 45 member 3
Gene symbol	SLC45A3
Synonyms (NCBI Gene)	IPCA-2IPCA-6IPCA-8IPCA6PCANAP2PCANAP6PCANAP8PRST
Chromosome	1
Chromosome location	1q32.1

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000798	hsa-miR-126-3p	Western blotLuciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Western blotLuciferase reporter assay	18193184
MIRT000797	hsa-miR-138-5p	Western blotLuciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Western blotLuciferase reporter assay	18193184
MIRT000798	hsa-miR-126-3p	Western blotLuciferase reporter assay	18193184
MIRT000797	hsa-miR-138-5p	Western blotLuciferase reporter assay	18193184
MIRT001820	hsa-miR-126-5p	Luciferase reporter assay	18193184
MIRT006716	hsa-miR-32-5p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	22521588
MIRT000798	hsa-miR-126-3p	Reporter assay;Other	18193184
MIRT001820	hsa-miR-126-5p	Reporter assay;Other	18193184
MIRT000797	hsa-miR-138-5p	Reporter assay;Other	18193184
MIRT439597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439597	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT000798	hsa-miR-126-3p	MicroarrayqRT-PCR	35816043
MIRT1364494	hsa-miR-137	CLIP-seq
MIRT1364495	hsa-miR-15a	CLIP-seq
MIRT1364496	hsa-miR-15b	CLIP-seq
MIRT1364497	hsa-miR-16	CLIP-seq
MIRT1364498	hsa-miR-195	CLIP-seq
MIRT1364499	hsa-miR-208a	CLIP-seq
MIRT1364500	hsa-miR-208b	CLIP-seq
MIRT1364501	hsa-miR-2110	CLIP-seq
MIRT1364502	hsa-miR-214	CLIP-seq
MIRT1364503	hsa-miR-25	CLIP-seq
MIRT1364504	hsa-miR-3147	CLIP-seq
MIRT1364505	hsa-miR-3150a-3p	CLIP-seq
MIRT1364506	hsa-miR-3162-3p	CLIP-seq
MIRT1364507	hsa-miR-32	CLIP-seq
MIRT1364508	hsa-miR-361-3p	CLIP-seq
MIRT1364509	hsa-miR-3619-5p	CLIP-seq
MIRT1364510	hsa-miR-363	CLIP-seq
MIRT1364511	hsa-miR-367	CLIP-seq
MIRT1364512	hsa-miR-424	CLIP-seq
MIRT1364513	hsa-miR-4291	CLIP-seq
MIRT1364514	hsa-miR-4425	CLIP-seq
MIRT1364515	hsa-miR-4450	CLIP-seq
MIRT1364516	hsa-miR-4713-3p	CLIP-seq
MIRT1364517	hsa-miR-497	CLIP-seq
MIRT1364518	hsa-miR-518a-5p	CLIP-seq
MIRT1364519	hsa-miR-527	CLIP-seq
MIRT1364520	hsa-miR-761	CLIP-seq
MIRT1364521	hsa-miR-885-3p	CLIP-seq
MIRT1364522	hsa-miR-922	CLIP-seq
MIRT1364523	hsa-miR-92a	CLIP-seq
MIRT1364524	hsa-miR-92b	CLIP-seq
MIRT1920917	hsa-miR-122	CLIP-seq
MIRT1920918	hsa-miR-3659	CLIP-seq
MIRT1920919	hsa-miR-4793-5p	CLIP-seq
MIRT1920917	hsa-miR-122	CLIP-seq
MIRT1920918	hsa-miR-3659	CLIP-seq
MIRT1920919	hsa-miR-4793-5p	CLIP-seq
MIRT2108167	hsa-miR-3128	CLIP-seq
MIRT2108168	hsa-miR-3185	CLIP-seq
MIRT2108169	hsa-miR-383	CLIP-seq
MIRT2108170	hsa-miR-4699-5p	CLIP-seq
MIRT2108171	hsa-miR-4720-5p	CLIP-seq
MIRT2108172	hsa-miR-4772-5p	CLIP-seq
MIRT2108173	hsa-miR-4799-3p	CLIP-seq
MIRT2331986	hsa-miR-1271	CLIP-seq
MIRT2331987	hsa-miR-182	CLIP-seq
MIRT2331988	hsa-miR-2355-5p	CLIP-seq
MIRT2331989	hsa-miR-323-3p	CLIP-seq
MIRT2331990	hsa-miR-4738-3p	CLIP-seq
MIRT1364521	hsa-miR-885-3p	CLIP-seq
MIRT2331991	hsa-miR-96	CLIP-seq
MIRT2440544	hsa-miR-3664-5p	CLIP-seq
MIRT2440545	hsa-miR-4528	CLIP-seq
MIRT2440546	hsa-miR-4714-5p	CLIP-seq
MIRT2440544	hsa-miR-3664-5p	CLIP-seq
MIRT2440545	hsa-miR-4528	CLIP-seq
MIRT2440546	hsa-miR-4714-5p	CLIP-seq
MIRT2459765	hsa-miR-1827	CLIP-seq
MIRT2459766	hsa-miR-3130-5p	CLIP-seq
MIRT2459767	hsa-miR-3649	CLIP-seq
MIRT2459768	hsa-miR-4290	CLIP-seq
MIRT2459769	hsa-miR-4316	CLIP-seq
MIRT2459770	hsa-miR-4482	CLIP-seq
MIRT2459771	hsa-miR-711	CLIP-seq
MIRT2459772	hsa-miR-940	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence
GO:0005886	Component	Plasma membrane	TAS
GO:0008506	Function	Sucrose:proton symporter activity	IBA
GO:0008506	Function	Sucrose:proton symporter activity	IEA
GO:0008506	Function	Sucrose:proton symporter activity	ISS
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0010907	Process	Positive regulation of glucose metabolic process	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	ISS
GO:0015293	Function	Symporter activity	IEA
GO:0015770	Process	Sucrose transport	IEA
GO:0015770	Process	Sucrose transport	ISS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	ISS
GO:0048713	Process	Regulation of oligodendrocyte differentiation	IEA
GO:0048713	Process	Regulation of oligodendrocyte differentiation	ISS
GO:0051119	Function	Sugar transmembrane transporter activity	TAS
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605097	8642	ENSG00000158715

Q96JT2

Protein name

Solute carrier family 45 member 3 (Prostate cancer-associated protein 6) (Prostein)

Protein function

Proton-associated sucrose transporter. May be able to transport also glucose and fructose.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	18 → 305	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Prostate specific. Expressed in all prostatic glandular cells. Expressed both in normal and cancerous prostates. {ECO:0000269|PubMed:11245466, ECO:0000269|PubMed:14997204}.

Sequence

MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG
PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL
ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA
IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH
CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL
YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA
AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG
ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA
RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ
VVFDKSDLAKYSA

Sequence length

553

Interactions

View interactions

	KEGG		Reactome
	Transcriptional misregulation in cancer MicroRNAs in cancer		Cellular hexose transport

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Teratoma	Uncertain significance	rs765881137	RCV003221379

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	38218896
Carcinogenesis	Associate	36337169
Carcinoma Hepatocellular	Associate	38218896
Gastrointestinal Neoplasms	Stimulate	38218896
Melanoma	Associate	34334114
Neoplasm Metastasis	Associate	28555048
Neoplasms	Associate	25188740
Prostatic Neoplasms	Associate	18193184, 19293179, 19649210, 20406994, 20526349, 21178489, 24925052, 27700103, 28235401, 28467780, 32753032, 38017230, 38218896
Prostatitis	Associate	20406994
Prostatitis	Stimulate	38218896
Salivary Gland Neoplasms	Stimulate	38218896
Urinary Bladder Neoplasms	Associate	33762601

SLC45A3 (solute carrier family 45 member 3)