Gene Gene information from NCBI Gene database.
Entrez ID 85407
Gene name NKD inhibitor of Wnt signaling pathway 1
Gene symbol NKD1
Synonyms (NCBI Gene)
Naked1
Chromosome 16
Chromosome location 16q12.1
Summary In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM, Jun 2003]
miRNA miRNA information provided by mirtarbase database.
567
miRTarBase ID miRNA Experiments Reference
MIRT030499 hsa-miR-24-3p Microarray 19748357
MIRT687463 hsa-miR-216b-5p HITS-CLIP 23313552
MIRT687462 hsa-miR-6854-5p HITS-CLIP 23313552
MIRT687461 hsa-miR-6890-3p HITS-CLIP 23313552
MIRT687460 hsa-miR-6840-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0000159 Component Protein phosphatase type 2A complex IDA 15687260
GO:0001754 Process Eye photoreceptor cell differentiation ISS 15687260
GO:0003401 Process Axis elongation IEA
GO:0003401 Process Axis elongation ISS
GO:0005509 Function Calcium ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607851 17045 ENSG00000140807
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969G9
Protein name Protein naked cuticle homolog 1 (Naked-1) (hNkd) (hNkd1)
Protein function Cell autonomous antagonist of the canonical Wnt signaling pathway. May activate a second Wnt signaling pathway that controls planar cell polarity.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in colon, heart, kidney, leukocyte, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine and spleen. {ECO:0000269|PubMed:11604995}.
Sequence
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIG
RSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLK
FEELQCDVSMEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKM
LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
EAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGH
VARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT
Sequence length 470
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Wnt signaling pathway
Hippo signaling pathway