Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85407
Gene name Gene Name - the full gene name approved by the HGNC.
NKD inhibitor of Wnt signaling pathway 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NKD1
Synonyms (NCBI Gene) Gene synonyms aliases
Naked1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM, Jun 2003]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030499 hsa-miR-24-3p Microarray 19748357
MIRT687463 hsa-miR-216b-5p HITS-CLIP 23313552
MIRT687462 hsa-miR-6854-5p HITS-CLIP 23313552
MIRT687461 hsa-miR-6890-3p HITS-CLIP 23313552
MIRT687460 hsa-miR-6840-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000159 Component Protein phosphatase type 2A complex IDA 15687260
GO:0001754 Process Eye photoreceptor cell differentiation ISS 15687260
GO:0003401 Process Axis elongation IEA
GO:0003401 Process Axis elongation ISS
GO:0005509 Function Calcium ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607851 17045 ENSG00000140807
Protein
UniProt ID Q969G9
Protein name Protein naked cuticle homolog 1 (Naked-1) (hNkd) (hNkd1)
Protein function Cell autonomous antagonist of the canonical Wnt signaling pathway. May activate a second Wnt signaling pathway that controls planar cell polarity.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in colon, heart, kidney, leukocyte, liver, lung, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine and spleen. {ECO:0000269|PubMed:11604995}.
Sequence
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIG
RSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLK
FEELQCDVSMEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKM
LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
EAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGH
VARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT
Sequence length 470
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Wnt signaling pathway
Hippo signaling pathway
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Allergic Sensitization Allergic sensitization N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Stimulate 18414471
Adenoma Associate 33423702
Breast Neoplasms Associate 26097589
Carcinoma Ductal Breast Associate 26097589
Carcinoma Non Small Cell Lung Inhibit 21599923
Colonic Neoplasms Associate 34547189
Colorectal Neoplasms Stimulate 34547189
Colorectal Neoplasms Associate 36445120
Crohn Disease Associate 40226707
Depressive Disorder Associate 40226707