Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8538
Gene name Gene Name - the full gene name approved by the HGNC.
BARX homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BARX2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogene
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017365 hsa-miR-335-5p Microarray 18185580
MIRT039194 hsa-miR-769-5p CLASH 23622248
MIRT815925 hsa-miR-1225-5p CLIP-seq
MIRT815926 hsa-miR-124 CLIP-seq
MIRT815927 hsa-miR-1273d CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IMP 14744868
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604823 956 ENSG00000043039
Protein
UniProt ID Q9UMQ3
Protein name Homeobox protein BarH-like 2
Protein function Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous syste
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 134 190 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta.
Sequence
MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS
CTGSPSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSE
SETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW
YQNRRMKWKK
MVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQ
EELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS
Sequence length 279
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35095769, 36793937
Lymphatic Metastasis Associate 36793937
Lymphoma B Cell Associate 30308041