Gene Gene information from NCBI Gene database.
Entrez ID 8538
Gene name BARX homeobox 2
Gene symbol BARX2
Synonyms (NCBI Gene)
-
Chromosome 11
Chromosome location 11q24.3
Summary This gene encodes a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogene
miRNA miRNA information provided by mirtarbase database.
135
miRTarBase ID miRNA Experiments Reference
MIRT017365 hsa-miR-335-5p Microarray 18185580
MIRT039194 hsa-miR-769-5p CLASH 23622248
MIRT815925 hsa-miR-1225-5p CLIP-seq
MIRT815926 hsa-miR-124 CLIP-seq
MIRT815927 hsa-miR-1273d CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IMP 14744868
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604823 956 ENSG00000043039
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UMQ3
Protein name Homeobox protein BarH-like 2
Protein function Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous syste
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 134 190 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in adult salivary gland and at much lower levels in mammary gland, kidney and placenta.
Sequence
MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS
CTGSPSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSE
SETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW
YQNRRMKWKK
MVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQ
EELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS
Sequence length 279
Interactions View interactions