Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
85363
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM5
Synonyms (NCBI Gene) Gene synonyms aliases
RNF88, TRIM5alpha
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-co
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052397 hsa-let-7a-5p CLASH 23622248
MIRT449416 hsa-miR-548u PAR-CLIP 22100165
MIRT449414 hsa-miR-7161-5p PAR-CLIP 22100165
MIRT449415 hsa-miR-8087 PAR-CLIP 22100165
MIRT449413 hsa-miR-4712-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 12878161, 20357094
GO:0002218 Process Activation of innate immune response IDA 21512573
GO:0002376 Process Immune system process IEA
GO:0003713 Function Transcription coactivator activity IDA 23077300
GO:0004842 Function Ubiquitin-protein transferase activity IDA 21512573
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608487 16276 ENSG00000132256
Protein
UniProt ID Q9C035
Protein name Tripartite motif-containing protein 5 (EC 2.3.2.27) (RING finger protein 88) (RING-type E3 ubiquitin transferase TRIM5)
Protein function Capsid-specific restriction factor that prevents infection from non-host-adapted retroviruses. Blocks viral replication early in the life cycle, after viral entry but before reverse transcription. In addition to acting as a capsid-specific restr
PDB 2ECV , 2YRG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 15 56 RING-type zinc-finger Domain
PF00643 zf-B_box 90 131 B-box zinc finger Domain
PF00622 SPRY 358 489 SPRY domain Family
Sequence
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLT
EEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQ
GSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHY
WEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
KCGVPMTLC
SPSS
Sequence length 493
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Viral life cycle - HIV-1
Human immunodeficiency virus 1 infection
  Interferon gamma signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Neuroblastoma Neuroblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 16081321, 19577266
Acute Retroviral Syndrome Associate 16081321, 16472833, 16474118, 16925802, 23369348, 24983760, 33052966
Acute Retroviral Syndrome Inhibit 22078707
Behcet Syndrome Associate 37264476
COVID 19 Associate 36028902, 36621405
Glioma Stimulate 37367937
Hepatitis B Associate 27590274
Hepatitis Viral Human Associate 27590274
Heroin Dependence Associate 28104465
HIV Infections Associate 16081321, 17400754, 18248091, 18586294, 20588169, 24367701, 27083474, 33052966, 34069225