Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8517
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IKBKG
Synonyms (NCBI Gene) Gene synonyms aliases
AMCBX1, EDAID1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, SAIDX, ZC2HC9
Disease Acronyms (UniProt) Disease acronyms from UniProt database
EDAID1, IMD33, IP, SAIDX
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in in
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853321 A>G Pathogenic Terminator codon variant, non coding transcript variant, stop lost
rs137853322 A>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs137853323 C>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs137853324 G>T Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs137853325 T>C Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051313 hsa-miR-15a-5p CLASH 23622248
MIRT613718 hsa-miR-8485 HITS-CLIP 21572407
MIRT613714 hsa-miR-4789-3p HITS-CLIP 21572407
MIRT613713 hsa-miR-5580-3p HITS-CLIP 21572407
MIRT613711 hsa-miR-4789-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IPI 17314283
GO:0000187 Process Activation of MAPK activity TAS
GO:0000922 Component Spindle pole IDA 24561039
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway TAS
GO:0002479 Process Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300248 5961 ENSG00000269335
Protein
UniProt ID Q9Y6K9
Protein name NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifi
Protein function Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor (PubMed:14695475, PubMed:20724660, PubM
PDB 2JVX , 2JVY , 3BRT , 3BRV , 3CL3 , 3FX0 , 4BWN , 5AAY , 5LDE , 6MI3 , 6MI4 , 6XX0 , 6YEK , 7T2U , 7TV4 , 8U7C , 9AZJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11577 NEMO 44 111 NF-kappa-B essential modulator NEMO Family
PF16516 CC2-LZ 247 344 Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator Coiled-coil
PF18414 zf_C2H2_10 393 418 Domain
Tissue specificity TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Sequence
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEK
LDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLK
ASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Sequence length 419
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Antifolate resistance
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Alcoholic liver disease
Alzheimer disease
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection
Chagas disease
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Viral carcinogenesis
Chemical carcinogenesis - reactive oxygen species
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Primary immunodeficiency
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  Activation of NF-kappaB in B cells
ER-Phagosome pathway
NOD1/2 Signaling Pathway
TICAM1, RIP1-mediated IKK complex recruitment
RIP-mediated NFkB activation via ZBP1
Downstream TCR signaling
FCERI mediated NF-kB activation
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
SUMOylation of immune response proteins
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
IKBKB deficiency causes SCID
IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR)
IkBA variant leads to EDA-ID
CLEC7A (Dectin-1) signaling
MAP3K8 (TPL2)-dependent MAPK1/3 activation
Ub-specific processing proteases
Ovarian tumor domain proteases
Interleukin-1 signaling
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
IRAK1 recruits IKK complex
IKK complex recruitment mediated by RIP1
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia ANEMIA, NONSPHEROCYTIC HEMOLYTIC, DUE TO G6PD DEFICIENCY rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
29339739, 30315739, 10502785, 16329560, 11601226
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure ClinVar
Ectodermal Dysplasia ectodermal dysplasia and immune deficiency, ectodermal dysplasia and immunodeficiency 1 GenCC
Immunodeficiency immunodeficiency 33 GenCC
Anhidrotic Ectodermal Dysplasia-Immunodeficiency-Osteopetrosis-Lymphedema Syndrome anhidrotic ectodermal dysplasia-immunodeficiency-osteopetrosis-lymphedema syndrome GenCC
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Inhibit 39337357
Alopecia Associate 30659980
Anodontia Associate 30659980
Autoimmune Diseases Associate 22235006
Bacterial Infections Associate 14523047, 29269280
Behcet Syndrome Associate 26812624
Blister Associate 35768795
Brain Diseases Associate 22805531, 27411570
Breast Neoplasms Associate 28402272, 28990063, 32736587
Carcinogenesis Associate 18313693, 19033441, 28931678, 40028213