Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84961
Gene name Gene Name - the full gene name approved by the HGNC.
F-box and leucine rich repeat protein 20
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXL20
Synonyms (NCBI Gene) Gene synonyms aliases
Fbl2, Fbl20
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
Members of the F-box protein family, such as FBXL20, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046059 hsa-miR-125b-5p CLASH 23622248
MIRT709424 hsa-miR-624-5p HITS-CLIP 19536157
MIRT709423 hsa-miR-6838-3p HITS-CLIP 19536157
MIRT709422 hsa-miR-554 HITS-CLIP 19536157
MIRT709421 hsa-miR-517-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001662 Process Behavioral fear response IEA
GO:0005515 Function Protein binding IPI 27705803, 32296183, 33961781, 34731788
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0019005 Component SCF ubiquitin ligase complex IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609086 24679 ENSG00000108306
Protein
UniProt ID Q96IG2
Protein name F-box/LRR-repeat protein 20 (F-box and leucine-rich repeat protein 20) (F-box/LRR-repeat protein 2-like)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Role in neural transmission (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12937 F-box-like 26 70 F-box-like Domain
PF13516 LRR_6 141 165 Leucine Rich repeat Repeat
PF13516 LRR_6 167 191 Leucine Rich repeat Repeat
PF13516 LRR_6 219 243 Leucine Rich repeat Repeat
PF13516 LRR_6 323 347 Leucine Rich repeat Repeat
Sequence
MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLAL
DGSNWQRIDL
FDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIE
VLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCD
QVTKDGIQALV
RGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLI
TIC
RGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE
LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIE
LDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPP
SVGGSRQRFCRCCIIL
Sequence length 436
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma, Asthma (childhood onset) N/A N/A GWAS
Biliary Cholangitis Primary biliary cholangitis N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 34587475
Neoplasms Associate 34587475, 34731788
Obesity Associate 37252693
Pancreatic Neoplasms Inhibit 34731788