Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84957
Gene name Gene Name - the full gene name approved by the HGNC.
RELT TNF receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RELT
Synonyms (NCBI Gene) Gene synonyms aliases
AI3C, TNFRSF19L, TRLT
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). T
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs762816338 G>A,C,T Pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs772929908 CT>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs1565222166 A>G Pathogenic Splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT495382 hsa-miR-1264 PAR-CLIP 23708386
MIRT495380 hsa-miR-4323 PAR-CLIP 23708386
MIRT495379 hsa-miR-3691-3p PAR-CLIP 23708386
MIRT495378 hsa-miR-6849-3p PAR-CLIP 23708386
MIRT495377 hsa-miR-766-3p PAR-CLIP 23708386
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16530727, 22052202
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611211 13764 ENSG00000054967
Protein
UniProt ID Q969Z4
Protein name Tumor necrosis factor receptor superfamily member 19L (Receptor expressed in lymphoid tissues)
Protein function May play a role in apoptosis (PubMed:19969290, PubMed:28688764). Induces activation of MAPK14/p38 and MAPK8/JNK MAPK cascades, when overexpressed (PubMed:16530727). Involved in dental enamel formation (PubMed:30506946). {ECO:0000269|PubMed:16530
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12606 RELT 163 202 Tumour necrosis factor receptor superfamily member 19 Family
Tissue specificity TISSUE SPECIFICITY: Spleen, lymph node, brain, breast and peripheral blood leukocytes (at protein level) (PubMed:28688764). Expressed highly in bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in kidney and p
Sequence
MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAW
GSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHG
CDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGI
LVCNLLKRKGYHCTAHKEVGPG
PGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAA
LEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQ
KKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRT
SSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYV
VRLSESNLVI
Sequence length 430
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cytokine-cytokine receptor interaction  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amelogenesis imperfecta Amelogenesis imperfecta, type 3c rs772929908, rs762816338, rs1565222166, rs1866200282 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amelogenesis Imperfecta Associate 30506946, 32052416, 37670079
Carcinoma Small Cell Associate 32052416
Cardiovascular Diseases Associate 37079385
Dental Enamel Hypoplasia Associate 30506946, 37670079
Growth Disorders Associate 30506946
Infections Associate 32052416
Leukemia Associate 11313261
Neurofibromatosis Noonan syndrome Associate 32052416
Squamous Cell Carcinoma of Head and Neck Associate 34917682
Stomach Neoplasms Stimulate 30873760