Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84929
Gene name Gene Name - the full gene name approved by the HGNC.
Fibrinogen C domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FIBCD1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.12
Summary Summary of gene provided in NCBI Entrez Gene.
FIBCD1 is a conserved type II transmembrane endocytic receptor that binds chitin and is located primarily in the intestinal brush border (Schlosser et al., 2009 [PubMed 19710473]).[supplied by OMIM, Apr 2010]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017721 hsa-miR-335-5p Microarray 18185580
MIRT486519 hsa-miR-4285 PAR-CLIP 23592263
MIRT486517 hsa-miR-6770-5p PAR-CLIP 23592263
MIRT486516 hsa-miR-6717-5p PAR-CLIP 23592263
MIRT486515 hsa-miR-92b-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA 21873635
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005615 Component Extracellular space IBA 21873635
GO:0007155 Process Cell adhesion IBA 21873635
GO:0008061 Function Chitin binding IDA 19710473
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613357 25922 ENSG00000130720
Protein
UniProt ID Q8N539
Protein name Fibrinogen C domain-containing protein 1
Protein function Acetyl group-binding receptor which shows a high-affinity and calcium-dependent binding to acetylated structures such as chitin, some N-acetylated carbohydrates, and amino acids, but not to their non-acetylated counterparts. Can facilitate the e
PDB 4M7F , 4M7H , 6ZQR , 6ZQX , 6ZQY , 6ZR0 , 6ZR3 , 6ZR4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 240 457 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the small and large intestinal epithelial cells with a highly polarized localization to the apical surface corresponding to the brush border and in the ducts of the salivary gland. {ECO:0000269|PubMed:19710473}.
Sequence
MVNDRWKTMGGAAQLEDRPRDKPQRPSCGYVLCTVLLALAVLLAVAVTGAVLFLNHAHAP
GTAPPPVVSTGAASANSALVTVERADSSHLSILIDPRCPDLTDSFARLESAQASVLQALT
EHQAQPRLVGDQEQELLDTLADQLPRLLARASELQTECMGLRKGHGTLGQGLSALQSEQG
RLIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQRAPARGTRPRGCATGSR
PRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWD
AYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFSVDPE
EDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLN
GQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPV
REDR
Sequence length 461
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Insomnia Insomnia GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Triple Negative Breast Neoplasms Associate 34326372