Gene Gene information from NCBI Gene database.
Entrez ID 84929
Gene name Fibrinogen C domain containing 1
Gene symbol FIBCD1
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q34.12
Summary FIBCD1 is a conserved type II transmembrane endocytic receptor that binds chitin and is located primarily in the intestinal brush border (Schlosser et al., 2009 [PubMed 19710473]).[supplied by OMIM, Apr 2010]
miRNA miRNA information provided by mirtarbase database.
182
miRTarBase ID miRNA Experiments Reference
MIRT017721 hsa-miR-335-5p Microarray 18185580
MIRT486519 hsa-miR-4285 PAR-CLIP 23592263
MIRT486517 hsa-miR-6770-5p PAR-CLIP 23592263
MIRT486516 hsa-miR-6717-5p PAR-CLIP 23592263
MIRT486515 hsa-miR-92b-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005615 Component Extracellular space IBA
GO:0008061 Function Chitin binding IDA 19710473
GO:0008061 Function Chitin binding IEA
GO:0016020 Component Membrane IDA 19710473
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613357 25922 ENSG00000130720
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N539
Protein name Fibrinogen C domain-containing protein 1
Protein function Acetyl group-binding receptor which shows a high-affinity and calcium-dependent binding to acetylated structures such as chitin, some N-acetylated carbohydrates, and amino acids, but not to their non-acetylated counterparts. Can facilitate the e
PDB 4M7F , 4M7H , 6ZQR , 6ZQX , 6ZQY , 6ZR0 , 6ZR3 , 6ZR4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 240 457 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the small and large intestinal epithelial cells with a highly polarized localization to the apical surface corresponding to the brush border and in the ducts of the salivary gland. {ECO:0000269|PubMed:19710473}.
Sequence
MVNDRWKTMGGAAQLEDRPRDKPQRPSCGYVLCTVLLALAVLLAVAVTGAVLFLNHAHAP
GTAPPPVVSTGAASANSALVTVERADSSHLSILIDPRCPDLTDSFARLESAQASVLQALT
EHQAQPRLVGDQEQELLDTLADQLPRLLARASELQTECMGLRKGHGTLGQGLSALQSEQG
RLIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQRAPARGTRPRGCATGSR
PRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWD
AYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFSVDPE
EDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLN
GQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPV
REDR
Sequence length 461
Interactions View interactions