Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein
Entrez ID	84913
Gene name	Atonal bHLH transcription factor 8
Gene symbol	ATOH8
Synonyms (NCBI Gene)	HATH6bHLHa21
Chromosome	2
Chromosome location	2p11.2

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016345	hsa-miR-193b-3p	Microarray	20304954
MIRT022278	hsa-miR-124-3p	Microarray	18668037
MIRT669431	hsa-miR-603	HITS-CLIP	23824327
MIRT669430	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT669429	hsa-miR-6078	HITS-CLIP	23824327
MIRT669428	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT669427	hsa-miR-3917	HITS-CLIP	23824327
MIRT669426	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT669425	hsa-miR-6720-3p	HITS-CLIP	23824327
MIRT669431	hsa-miR-603	HITS-CLIP	23824327
MIRT669430	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT669429	hsa-miR-6078	HITS-CLIP	23824327
MIRT669428	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT669427	hsa-miR-3917	HITS-CLIP	23824327
MIRT669426	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT669425	hsa-miR-6720-3p	HITS-CLIP	23824327
MIRT806199	hsa-miR-1254	CLIP-seq
MIRT806200	hsa-miR-1287	CLIP-seq
MIRT806201	hsa-miR-1301	CLIP-seq
MIRT806202	hsa-miR-150	CLIP-seq
MIRT806203	hsa-miR-185	CLIP-seq
MIRT806204	hsa-miR-1912	CLIP-seq
MIRT806205	hsa-miR-1914	CLIP-seq
MIRT806206	hsa-miR-1972	CLIP-seq
MIRT806207	hsa-miR-3116	CLIP-seq
MIRT806208	hsa-miR-3125	CLIP-seq
MIRT806209	hsa-miR-3135b	CLIP-seq
MIRT806210	hsa-miR-3153	CLIP-seq
MIRT806211	hsa-miR-3173-3p	CLIP-seq
MIRT806212	hsa-miR-3194-5p	CLIP-seq
MIRT806213	hsa-miR-3202	CLIP-seq
MIRT806214	hsa-miR-320e	CLIP-seq
MIRT806215	hsa-miR-342-3p	CLIP-seq
MIRT806216	hsa-miR-3916	CLIP-seq
MIRT806217	hsa-miR-4294	CLIP-seq
MIRT806218	hsa-miR-4299	CLIP-seq
MIRT806219	hsa-miR-4306	CLIP-seq
MIRT806220	hsa-miR-4323	CLIP-seq
MIRT806221	hsa-miR-4433	CLIP-seq
MIRT806222	hsa-miR-4469	CLIP-seq
MIRT806223	hsa-miR-4533	CLIP-seq
MIRT806224	hsa-miR-4640-3p	CLIP-seq
MIRT806225	hsa-miR-4644	CLIP-seq
MIRT806226	hsa-miR-4646-5p	CLIP-seq
MIRT806227	hsa-miR-4650-5p	CLIP-seq
MIRT806228	hsa-miR-4660	CLIP-seq
MIRT806229	hsa-miR-4668-5p	CLIP-seq
MIRT806230	hsa-miR-4690-3p	CLIP-seq
MIRT806231	hsa-miR-4779	CLIP-seq
MIRT806232	hsa-miR-5047	CLIP-seq
MIRT806233	hsa-miR-550a	CLIP-seq
MIRT806234	hsa-miR-661	CLIP-seq
MIRT806235	hsa-miR-665	CLIP-seq
MIRT1938060	hsa-miR-1237	CLIP-seq
MIRT1938061	hsa-miR-128	CLIP-seq
MIRT1938062	hsa-miR-3156-3p	CLIP-seq
MIRT1938063	hsa-miR-3174	CLIP-seq
MIRT1938064	hsa-miR-3670	CLIP-seq
MIRT806218	hsa-miR-4299	CLIP-seq
MIRT1938065	hsa-miR-4301	CLIP-seq
MIRT1938066	hsa-miR-4505	CLIP-seq
MIRT1938067	hsa-miR-4512	CLIP-seq
MIRT1938068	hsa-miR-4645-5p	CLIP-seq
MIRT1938069	hsa-miR-4656	CLIP-seq
MIRT1938070	hsa-miR-4663	CLIP-seq
MIRT1938071	hsa-miR-4673	CLIP-seq
MIRT1938072	hsa-miR-4682	CLIP-seq
MIRT1938073	hsa-miR-4765	CLIP-seq
MIRT1938074	hsa-miR-4785	CLIP-seq
MIRT1938075	hsa-miR-4787-5p	CLIP-seq
MIRT1938076	hsa-miR-544	CLIP-seq
MIRT1938077	hsa-miR-767-3p	CLIP-seq
MIRT2177547	hsa-miR-1273f	CLIP-seq
MIRT806201	hsa-miR-1301	CLIP-seq
MIRT2177548	hsa-miR-143	CLIP-seq
MIRT806202	hsa-miR-150	CLIP-seq
MIRT2177549	hsa-miR-15a	CLIP-seq
MIRT2177550	hsa-miR-15b	CLIP-seq
MIRT2177551	hsa-miR-16	CLIP-seq
MIRT806204	hsa-miR-1912	CLIP-seq
MIRT2177552	hsa-miR-195	CLIP-seq
MIRT2177553	hsa-miR-24	CLIP-seq
MIRT806210	hsa-miR-3153	CLIP-seq
MIRT2177554	hsa-miR-3664-3p	CLIP-seq
MIRT2177555	hsa-miR-3675-5p	CLIP-seq
MIRT2177556	hsa-miR-424	CLIP-seq
MIRT2177557	hsa-miR-4269	CLIP-seq
MIRT2177558	hsa-miR-4283	CLIP-seq
MIRT806218	hsa-miR-4299	CLIP-seq
MIRT2177559	hsa-miR-4326	CLIP-seq
MIRT2177560	hsa-miR-4434	CLIP-seq
MIRT2177561	hsa-miR-4437	CLIP-seq
MIRT2177562	hsa-miR-4489	CLIP-seq
MIRT2177563	hsa-miR-4514	CLIP-seq
MIRT2177564	hsa-miR-4516	CLIP-seq
MIRT806226	hsa-miR-4646-5p	CLIP-seq
MIRT806228	hsa-miR-4660	CLIP-seq
MIRT806229	hsa-miR-4668-5p	CLIP-seq
MIRT2177565	hsa-miR-4692	CLIP-seq
MIRT2177566	hsa-miR-4708-5p	CLIP-seq
MIRT2177567	hsa-miR-4742-5p	CLIP-seq
MIRT2177568	hsa-miR-4770	CLIP-seq
MIRT2177569	hsa-miR-4796-5p	CLIP-seq
MIRT2177570	hsa-miR-497	CLIP-seq
MIRT806232	hsa-miR-5047	CLIP-seq
MIRT2177571	hsa-miR-664	CLIP-seq
MIRT2384579	hsa-miR-2355-5p	CLIP-seq
MIRT2384580	hsa-miR-3160-3p	CLIP-seq
MIRT806215	hsa-miR-342-3p	CLIP-seq
MIRT806222	hsa-miR-4469	CLIP-seq
MIRT2384581	hsa-miR-4487	CLIP-seq
MIRT2384582	hsa-miR-4525	CLIP-seq
MIRT2384583	hsa-miR-4677-3p	CLIP-seq
MIRT2384584	hsa-miR-515-5p	CLIP-seq
MIRT1938076	hsa-miR-544	CLIP-seq
MIRT2384585	hsa-miR-558	CLIP-seq
MIRT2444348	hsa-miR-451b	CLIP-seq
MIRT2444349	hsa-miR-4696	CLIP-seq
MIRT2444348	hsa-miR-451b	CLIP-seq
MIRT2444349	hsa-miR-4696	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001704	Process	Formation of primary germ layer	IEA
GO:0001704	Process	Formation of primary germ layer	ISS
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IMP	24463812
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	24236640
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	26496921
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24463812
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	24463812
GO:0010629	Process	Negative regulation of gene expression	IMP	27780851
GO:0016607	Component	Nuclear speck	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0035148	Process	Tube formation	IMP	24463812
GO:0045603	Process	Positive regulation of endothelial cell differentiation	IDA	24463812
GO:0045603	Process	Positive regulation of endothelial cell differentiation	IMP	24463812
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	24236640
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051450	Process	Myoblast proliferation	ISS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	24236640
GO:0070888	Function	E-box binding	IBA
GO:0070888	Function	E-box binding	IDA	24236640
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IGI	27780851
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
619820	24126	ENSG00000168874

Q96SQ7

Protein name

Transcription factor ATOH8 (Class A basic helix-loop-helix protein 21) (bHLHa21) (Helix-loop-helix protein hATH-6) (hATH6) (Protein atonal homolog 8)

Protein function

Transcription factor that binds a palindromic (canonical) core consensus DNA sequence 5'-CANNTG- 3' known as an E-box element, possibly as a heterodimer with other bHLH proteins (PubMed:24236640). Regulates endothelial cell proliferation, migrat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	231 → 283	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung, liver, kidney, heart and pancreas. Expressed in endothel of umbilical vessels. {ECO:0000269|PubMed:12419857}.

Sequence

MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
RDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKRCFALGAVGPG
LPTPPPPPPPAPQSQAPGGPEAQPFREPGLRPRILLCAPPARPAPSAPPAPPAPPESTVR
PAPPTRPGESSYSSISHVIYNNHQDSSASPRKRPGEATAASSEIKALQQTRRLLANARER
TRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFS
ECVQRCTRTLQAEGRAKKRKE

Sequence length

321

Interactions

View interactions

ATOH8 (atonal bHLH transcription factor 8)