Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	84869
Gene name	Carbonyl reductase 4
Gene symbol	CBR4
Synonyms (NCBI Gene)	SDR45C1
Chromosome	4
Chromosome location	4q32.3

126

Show/Hide all (126)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020570	hsa-miR-155-5p	Proteomics	18668040
MIRT020570	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT023498	hsa-miR-1-3p	Proteomics	18668040
MIRT032121	hsa-let-7d-5p	Sequencing	20371350
MIRT865736	hsa-let-7a	CLIP-seq
MIRT865737	hsa-let-7b	CLIP-seq
MIRT865738	hsa-let-7c	CLIP-seq
MIRT865739	hsa-let-7d	CLIP-seq
MIRT865740	hsa-let-7e	CLIP-seq
MIRT865741	hsa-let-7f	CLIP-seq
MIRT865742	hsa-let-7g	CLIP-seq
MIRT865743	hsa-let-7i	CLIP-seq
MIRT865744	hsa-miR-122	CLIP-seq
MIRT865745	hsa-miR-137	CLIP-seq
MIRT865746	hsa-miR-139-5p	CLIP-seq
MIRT865747	hsa-miR-153	CLIP-seq
MIRT865748	hsa-miR-197	CLIP-seq
MIRT865749	hsa-miR-202	CLIP-seq
MIRT865750	hsa-miR-2116	CLIP-seq
MIRT865751	hsa-miR-214	CLIP-seq
MIRT865752	hsa-miR-221	CLIP-seq
MIRT865753	hsa-miR-222	CLIP-seq
MIRT865754	hsa-miR-25	CLIP-seq
MIRT865755	hsa-miR-32	CLIP-seq
MIRT865756	hsa-miR-3619-5p	CLIP-seq
MIRT865757	hsa-miR-3622a-3p	CLIP-seq
MIRT865758	hsa-miR-3622b-3p	CLIP-seq
MIRT865759	hsa-miR-363	CLIP-seq
MIRT865760	hsa-miR-367	CLIP-seq
MIRT865761	hsa-miR-409-3p	CLIP-seq
MIRT865762	hsa-miR-4254	CLIP-seq
MIRT865763	hsa-miR-4291	CLIP-seq
MIRT865764	hsa-miR-4458	CLIP-seq
MIRT865765	hsa-miR-4464	CLIP-seq
MIRT865766	hsa-miR-448	CLIP-seq
MIRT865767	hsa-miR-4481	CLIP-seq
MIRT865768	hsa-miR-4500	CLIP-seq
MIRT865769	hsa-miR-4539	CLIP-seq
MIRT865770	hsa-miR-4643	CLIP-seq
MIRT865771	hsa-miR-466	CLIP-seq
MIRT865772	hsa-miR-4698	CLIP-seq
MIRT865773	hsa-miR-4745-5p	CLIP-seq
MIRT865774	hsa-miR-4748	CLIP-seq
MIRT865775	hsa-miR-4789-3p	CLIP-seq
MIRT865776	hsa-miR-4796-5p	CLIP-seq
MIRT865777	hsa-miR-4803	CLIP-seq
MIRT865778	hsa-miR-501-5p	CLIP-seq
MIRT865779	hsa-miR-5096	CLIP-seq
MIRT865780	hsa-miR-518a-5p	CLIP-seq
MIRT865781	hsa-miR-527	CLIP-seq
MIRT865782	hsa-miR-548ag	CLIP-seq
MIRT865783	hsa-miR-548ai	CLIP-seq
MIRT865784	hsa-miR-548m	CLIP-seq
MIRT865785	hsa-miR-548v	CLIP-seq
MIRT865786	hsa-miR-619	CLIP-seq
MIRT865787	hsa-miR-657	CLIP-seq
MIRT865788	hsa-miR-761	CLIP-seq
MIRT865789	hsa-miR-922	CLIP-seq
MIRT865790	hsa-miR-92a	CLIP-seq
MIRT865791	hsa-miR-92b	CLIP-seq
MIRT865792	hsa-miR-98	CLIP-seq
MIRT1546219	hsa-miR-3163	CLIP-seq
MIRT1546220	hsa-miR-4282	CLIP-seq
MIRT1546221	hsa-miR-4325	CLIP-seq
MIRT1546222	hsa-miR-507	CLIP-seq
MIRT1546223	hsa-miR-557	CLIP-seq
MIRT1956750	hsa-miR-1197	CLIP-seq
MIRT1956751	hsa-miR-1258	CLIP-seq
MIRT1956752	hsa-miR-140-5p	CLIP-seq
MIRT1956753	hsa-miR-3117-3p	CLIP-seq
MIRT1956754	hsa-miR-3121-3p	CLIP-seq
MIRT1956755	hsa-miR-3154	CLIP-seq
MIRT1546219	hsa-miR-3163	CLIP-seq
MIRT1956756	hsa-miR-3672	CLIP-seq
MIRT1956757	hsa-miR-3942-3p	CLIP-seq
MIRT1956758	hsa-miR-433	CLIP-seq
MIRT1956759	hsa-miR-450b-5p	CLIP-seq
MIRT1956760	hsa-miR-4799-5p	CLIP-seq
MIRT1546222	hsa-miR-507	CLIP-seq
MIRT1546223	hsa-miR-557	CLIP-seq
MIRT2194025	hsa-miR-1183	CLIP-seq
MIRT2194026	hsa-miR-147b	CLIP-seq
MIRT2194027	hsa-miR-3143	CLIP-seq
MIRT2194028	hsa-miR-3674	CLIP-seq
MIRT865769	hsa-miR-4539	CLIP-seq
MIRT2194029	hsa-miR-4678	CLIP-seq
MIRT2194030	hsa-miR-4705	CLIP-seq
MIRT2194031	hsa-miR-4773	CLIP-seq
MIRT865777	hsa-miR-4803	CLIP-seq
MIRT2194032	hsa-miR-543	CLIP-seq
MIRT2194033	hsa-miR-545	CLIP-seq
MIRT2194034	hsa-miR-548aa	CLIP-seq
MIRT865782	hsa-miR-548ag	CLIP-seq
MIRT865783	hsa-miR-548ai	CLIP-seq
MIRT865785	hsa-miR-548v	CLIP-seq
MIRT2194035	hsa-miR-637	CLIP-seq
MIRT2194036	hsa-miR-767-3p	CLIP-seq
MIRT2497410	hsa-miR-1200	CLIP-seq
MIRT2497411	hsa-miR-3129-3p	CLIP-seq
MIRT2497412	hsa-miR-3135	CLIP-seq
MIRT2497413	hsa-miR-337-3p	CLIP-seq
MIRT2497414	hsa-miR-3685	CLIP-seq
MIRT2497415	hsa-miR-384	CLIP-seq
MIRT2497416	hsa-miR-3909	CLIP-seq
MIRT2497417	hsa-miR-4302	CLIP-seq
MIRT2497418	hsa-miR-4303	CLIP-seq
MIRT2497419	hsa-miR-4324	CLIP-seq
MIRT2497420	hsa-miR-455-5p	CLIP-seq
MIRT2497421	hsa-miR-4682	CLIP-seq
MIRT1956760	hsa-miR-4799-5p	CLIP-seq
MIRT2497422	hsa-miR-512-3p	CLIP-seq
MIRT2497423	hsa-miR-544b	CLIP-seq
MIRT2497424	hsa-miR-549	CLIP-seq
MIRT2497425	hsa-miR-550a	CLIP-seq
MIRT2497426	hsa-miR-577	CLIP-seq
MIRT2497427	hsa-miR-607	CLIP-seq
MIRT2497410	hsa-miR-1200	CLIP-seq
MIRT2497413	hsa-miR-337-3p	CLIP-seq
MIRT2497414	hsa-miR-3685	CLIP-seq
MIRT2497415	hsa-miR-384	CLIP-seq
MIRT2497418	hsa-miR-4303	CLIP-seq
MIRT2497419	hsa-miR-4324	CLIP-seq
MIRT2497420	hsa-miR-455-5p	CLIP-seq
MIRT2497421	hsa-miR-4682	CLIP-seq
MIRT2497422	hsa-miR-512-3p	CLIP-seq
MIRT2497423	hsa-miR-544b	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003955	Function	NAD(P)H dehydrogenase (quinone) activity	IDA	20837989
GO:0004316	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	IDA	19571038
GO:0004316	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	IEA
GO:0004316	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	IMP	25203508
GO:0004316	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	TAS
GO:0005515	Function	Protein binding	IPI	19571038, 25203508, 28514442, 32296183, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	19000905, 19571038
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IMP	25203508
GO:0008753	Function	NADPH dehydrogenase (quinone) activity	IDA	19000905
GO:0008753	Function	NADPH dehydrogenase (quinone) activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA
GO:0044597	Process	Daunorubicin metabolic process	IMP	20837989
GO:0044598	Process	Doxorubicin metabolic process	IMP	20837989
GO:0046949	Process	Fatty-acyl-CoA biosynthetic process	TAS
GO:0048038	Function	Quinone binding	IBA
GO:0048038	Function	Quinone binding	IDA	19000905
GO:0051289	Process	Protein homotetramerization	IDA	19000905
GO:0051290	Process	Protein heterotetramerization	IDA	25203508
GO:0070402	Function	NADPH binding	IDA	19000905, 25203508
GO:1990204	Component	Oxidoreductase complex	IDA	19571038
GO:1990204	Component	Oxidoreductase complex	IMP	25203508

MIM	HGNC	e!Ensembl
619394	25891	ENSG00000145439

Q8N4T8

Protein name

3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) (3-ketoacyl-[acyl-carrier-protein] reductase beta subunit) (KAR beta subunit) (Carbonyl reductase family member 4) (CBR4) (Quinone reductase CBR4) (EC 1.6.5.10) (Short chain dehydrogenase/reductase

Protein function

Component of the heterotetramer complex KAR (3-ketoacyl-[acyl carrier protein] reductase or 3-ketoacyl-[ACP] reductase) that forms part of the mitochondrial fatty acid synthase (mtFAS). Beta-subunit of the KAR heterotetramer complex, responsible

PDB

4CQL , 4CQM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13561	adh_short_C2	8 → 234		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver and kidney (at protein level) (PubMed:19000905). Displays the highest expression in neuronal and muscle tissues (PubMed:25203508). {ECO:0000269|PubMed:19000905, ECO:0000303|PubMed:25203508}.

Sequence

MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKE
HDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMR
TMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGF
VHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL

Sequence length

237

Interactions

View interactions

	KEGG		Reactome
	Fatty acid biosynthesis Metabolic pathways Fatty acid metabolism		Fatty acyl-CoA biosynthesis

CBR4 (carbonyl reductase 4)