RIOX2 (ribosomal oxygenase 2)

Gene

• Entrez ID: 84864
• Gene name: Ribosomal oxygenase 2
• Gene symbol: RIOX2
• Synonyms (NCBI Gene): JMJD10, MDIG, MINA, MINA53, NO52, ROX
• Chromosome: 3
• Chromosome location: 3q11.2
• Summary: MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT718291	hsa-miR-8485	HITS-CLIP	19536157
MIRT718290	hsa-miR-603	HITS-CLIP	19536157
MIRT718289	hsa-miR-216b-3p	HITS-CLIP	19536157
MIRT718288	hsa-miR-4796-5p	HITS-CLIP	19536157
MIRT718287	hsa-miR-6516-3p	HITS-CLIP	19536157
MIRT446659	hsa-miR-651-3p	PAR-CLIP	22100165
MIRT446658	hsa-miR-4760-3p	PAR-CLIP	22100165
MIRT446657	hsa-miR-4496	PAR-CLIP	22100165
MIRT446656	hsa-miR-183-3p	PAR-CLIP	22100165
MIRT446655	hsa-miR-4452	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0032452	Function	Histone demethylase activity	TAS
GO:0032453	Function	Histone H3K4 demethylase activity	IBA
GO:0036139	Function	Peptidyl-histidine dioxygenase activity	EXP	23103944
GO:0036139	Function	Peptidyl-histidine dioxygenase activity	IDA	23103944
GO:0036139	Function	Peptidyl-histidine dioxygenase activity	IEA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 32296183
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051864	Function	Histone H3K36 demethylase activity	IBA

Other IDs

• MIM: 612049
• HGNC: 19441
• e!Ensembl: ENSG00000170854

Protein

• UniProt ID: Q8IUF8
• Protein name: Ribosomal oxygenase 2 (60S ribosomal protein L27a histidine hydroxylase) (Bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA) (EC 1.14.11.79) (Histone lysine demethylase MINA) (MYC-induced nuclear antigen) (Mineral dust-induced gene pr
• Protein function: Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Is involved in the demethylation of trimethylated 'Lys-9' on histone H3 (H3K9me3), leading to an increase in ribosomal RNA expression. Also cataly
• PDB: 2XDV, 4BU2, 4BXF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08007	Cupin_4	51 → 364	Cupin superfamily protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in liver, skeletal muscle, heart, pancreas, and placenta. Not detected in brain, lung or kidney. Expressed in several lung cancer tissues, but is barely detected in the adjacent non-cancerous tissues. Also highly expressed in
• Sequence:

  MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWE
  QKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAH
  FLQLRKDFDQKRATIQFHQPQRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHY
  DDVEVFILQLEGEKHWRLYHPTVPLAREYSVEAEERIGRPVHEFMLKPGDLLYFPRGTIH
  QADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTAKEDVELRTGIPRQLLLQVES
  TTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAELSTPGGKLPRL
  DSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP
  LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV

• Sequence length: 465

Pathways

Reactome:

HDMs demethylate histones

<