Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84766
Gene name Gene Name - the full gene name approved by the HGNC.	Calcium release activated channel regulator 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRACR2A
Synonyms (NCBI Gene) Gene synonyms aliases	EFCAB4B, RAB46
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.32

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	27016526
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001772	Component	Immunological synapse	IDA	27016526
GO:0002115	Process	Store-operated calcium entry	IMP	20418871
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	27016526
GO:0003925	Function	G protein activity	IMP	27016526
GO:0005509	Function	Calcium ion binding	IDA	20418871
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	20418871, 23088713, 25416956, 28514442, 31092558, 31515488, 32296183, 32814053, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA	20418871, 30814157, 31092558
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005815	Component	Microtubule organizing center	IDA	30814157, 31092558
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	30814157
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0008104	Process	Intracellular protein localization	IMP	20418871
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0016197	Process	Endosomal transport	IDA	30814157
GO:0016787	Function	Hydrolase activity	IEA
GO:0031982	Component	Vesicle	IDA	27016526
GO:0031982	Component	Vesicle	IEA
GO:0032237	Process	Activation of store-operated calcium channel activity	IMP	20418871, 27016526
GO:0032588	Component	Trans-Golgi network membrane	IDA	27016526
GO:0033093	Component	Weibel-Palade body	IDA	31092558
GO:0034776	Process	Response to histamine	IDA	31092558
GO:0035580	Component	Specific granule lumen	TAS
GO:0042581	Component	Specific granule	IEA
GO:0045063	Process	T-helper 1 cell differentiation	IMP	29987160
GO:0046330	Process	Positive regulation of JNK cascade	IMP	27016526
GO:0046872	Function	Metal ion binding	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IEA
GO:0051928	Process	Positive regulation of calcium ion transport	IMP	20418871

MIM	HGNC	e!Ensembl
614178	28657	ENSG00000130038

Protein

UniProt ID

Q9BSW2

Protein name

EF-hand calcium-binding domain-containing protein 4B (Calcium release-activated calcium channel regulator 2A) (CRAC channel regulator 2A) (Calcium release-activated channel regulator 2A) (Ras-related protein Rab-46) (EC 3.6.5.2)

Protein function

[Isoform 1]: Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junc

PDB

6PSD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13499	EF-hand_7	52 → 114	EF-hand domain pair	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Expressed in the Jurkat T-cell line. {ECO:0000269|PubMed:27016526}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in endothelial cells (PubMed:25475730). Expressed in Weibel-Palade bodies (which are P-selectin/SELP negative)

Sequence

MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQ
TCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
NNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVK
QLWLQLKKEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEM
EQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHE
TKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEMEVYRVTESLQR
EKAGLLKQLDFLRCVGGHWPVLRAPPRSLGSEGPV

Sequence length

395

Interactions

View interactions

	Reactome
			Neutrophil degranulation

CRACR2A (calcium release activated channel regulator 2A)