HDGFL2 (HDGF like 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 84717
Gene name HDGF like 2
Gene symbol HDGFL2
Synonyms (NCBI Gene)
HDGF-2HDGF2HDGFRP2HRP-2HRP2
Chromosome 19
Chromosome location 19p13.3
Summary This gene encodes a member of the hepatoma-derived growth factor (HDGF) family. The protein includes an N-terminal PWWP domain that binds to methyl-lysine-containing histones, with specific binding of this protein to tri-methylated lysines 36 and 79 of hi
miRNA miRNA information provided by mirtarbase database.
17
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (17)
miRTarBase ID miRNA Experiments Reference
MIRT551602 hsa-miR-548ac PAR-CLIP 21572407
MIRT551601 hsa-miR-548bb-3p PAR-CLIP 21572407
MIRT551600 hsa-miR-548d-3p PAR-CLIP 21572407
MIRT551599 hsa-miR-548h-3p PAR-CLIP 21572407
MIRT551598 hsa-miR-548z PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (23)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21044950, 25689719, 26721387, 32459350
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 26721387
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617884 14680 ENSG00000167674
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z4V5
Protein name Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2)
Protein function Acts as an epigenetic regulator of myogenesis in cooperation with DPF3a (isoform 2 of DPF3/BAF45C) (PubMed:32459350). Associates with the BAF complex via its interaction with DPF3a and HDGFL2-DPF3a activate myogenic genes by increasing chromatin
PDB 3EAE , 3QBY , 3QJ6 , 6T3I , 7HG0 , 7HG1 , 7HG2 , 7HG3 , 7HG4 , 7HG5 , 7HG6 , 7HG7 , 7HG8 , 7HG9 , 7HGA , 7HGB , 7HGC , 7HGD , 7HGE , 7HGF , 7HGG , 7HGH , 7HGI , 7HGJ , 7HGK , 7HGL , 7HGM , 7HGN , 7HGO , 7HGP , 7HGQ , 7HGR , 7HGS , 7HGT , 7HGU , 7HGV , 7HGW , 7HGX , 7HGY , 7HGZ , 7HH0 , 7HH1 , 7HH2 , 7HH3 , 7HH4 , 7HH5 , 7HH6 , 7HH7 , 7HH8 , 7HH9 , 7HHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00855 PWWP 5 → 89 PWWP domain Domain
PF11467 LEDGF 472 → 573 Lens epithelium-derived growth factor (LEDGF) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High expression is found in heart, skeletal muscle, ovary and testis. Overexpression is frequently observed in hepatocellular carcinoma samples. {ECO:0000269|PubMed:25689719}.
Sequence 
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFP
YDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYSAPPPVSSSDSEAPEANPADGSDADEDD
EDRGVMAVTAVTATAASDRMESDSDSDKSSDNSGLKRKTPALKMSVSKRARKASSDLDQA
SVSPSEEENSESSSESEKTSDQDFTPEKKAAVRAPRRGPLGGRKKKKAPSASDSDSKADS
DGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPLPKPRGRKPKPERPPSS
SSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEKERRRERADRG
EAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSS
TEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHS
EIKFALKVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAA
EVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPSTDLSA
PVNGEATSQKGESAEDKEHEEGRDSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERA
RGDSEALDEES
Sequence length 671
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
16
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (16)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Likely benign rs180870155 RCV005936680
Clear cell carcinoma of kidney Likely benign rs180870155 RCV005936681
Colon adenocarcinoma Likely benign rs180870155 RCV005936676
Colorectal cancer Likely benign rs180870155 RCV005936683
Show/Hide Text Mining Associations (4)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 29763915
Emanuel syndrome Associate 35166240
Malaria Associate 29471833
Multiple Myeloma Associate 35166240