HDGFL2 (HDGF like 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84717
Gene name Gene Name - the full gene name approved by the HGNC.
HDGF like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HDGFL2
Synonyms (NCBI Gene) Gene synonyms aliases
HDGF-2, HDGF2, HDGFRP2, HRP-2, HRP2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the hepatoma-derived growth factor (HDGF) family. The protein includes an N-terminal PWWP domain that binds to methyl-lysine-containing histones, with specific binding of this protein to tri-methylated lysines 36 and 79 of hi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(17)
miRTarBase ID miRNA Experiments Reference
MIRT551602 hsa-miR-548ac PAR-CLIP 21572407
MIRT551601 hsa-miR-548bb-3p PAR-CLIP 21572407
MIRT551600 hsa-miR-548d-3p PAR-CLIP 21572407
MIRT551599 hsa-miR-548h-3p PAR-CLIP 21572407
MIRT551598 hsa-miR-548z PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0003690 Function Double-stranded DNA binding IBA 21873635
GO:0003712 Function Transcription coregulator activity IBA 21873635
GO:0005515 Function Protein binding IPI 21044950, 25689719
GO:0005634 Component Nucleus IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617884 14680 ENSG00000167674
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z4V5
Protein name Hepatoma-derived growth factor-related protein 2 (HDGF-related protein 2) (HRP-2) (Hepatoma-derived growth factor 2) (HDGF-2)
Protein function Acts as an epigenetic regulator of myogenesis in cooperation with DPF3a (isoform 2 of DPF3/BAF45C) (PubMed:32459350). Associates with the BAF complex via its interaction with DPF3a and HDGFL2-DPF3a activate myogenic genes by increasing chromatin
PDB 3EAE , 3QBY , 3QJ6 , 6T3I , 7HG0 , 7HG1 , 7HG2 , 7HG3 , 7HG4 , 7HG5 , 7HG6 , 7HG7 , 7HG8 , 7HG9 , 7HGA , 7HGB , 7HGC , 7HGD , 7HGE , 7HGF , 7HGG , 7HGH , 7HGI , 7HGJ , 7HGK , 7HGL , 7HGM , 7HGN , 7HGO , 7HGP , 7HGQ , 7HGR , 7HGS , 7HGT , 7HGU , 7HGV , 7HGW , 7HGX , 7HGY , 7HGZ , 7HH0 , 7HH1 , 7HH2 , 7HH3 , 7HH4 , 7HH5 , 7HH6 , 7HH7 , 7HH8 , 7HH9 , 7HHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00855 PWWP 5 → 89 PWWP domain Domain
PF11467 LEDGF 472 → 573 Lens epithelium-derived growth factor (LEDGF) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High expression is found in heart, skeletal muscle, ovary and testis. Overexpression is frequently observed in hepatocellular carcinoma samples. {ECO:0000269|PubMed:25689719}.
Sequence 
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFP
YDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYSAPPPVSSSDSEAPEANPADGSDADEDD
EDRGVMAVTAVTATAASDRMESDSDSDKSSDNSGLKRKTPALKMSVSKRARKASSDLDQA
SVSPSEEENSESSSESEKTSDQDFTPEKKAAVRAPRRGPLGGRKKKKAPSASDSDSKADS
DGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPLPKPRGRKPKPERPPSS
SSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEKERRRERADRG
EAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSS
TEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHS
EIKFALKVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAA
EVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPSTDLSA
PVNGEATSQKGESAEDKEHEEGRDSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERA
RGDSEALDEES
Sequence length 671
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Multiple Sclerosis Multiple Sclerosis GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 29763915
Emanuel syndrome Associate 35166240
Malaria Associate 29471833
Multiple Myeloma Associate 35166240