Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8468
Gene name Gene Name - the full gene name approved by the HGNC.
FKBP prolyl isomerase family member 6 (inactive)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FKBP6
Synonyms (NCBI Gene) Gene synonyms aliases
FKBP36, SPGF77
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cis-trans peptidyl-prolyl isomerase that may function in immunoregulation and basic cellular processes involving protein folding and trafficking. This gene is located in a chromosomal region that is deleted in William
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT997705 hsa-miR-3192 CLIP-seq
MIRT997706 hsa-miR-3199 CLIP-seq
MIRT997707 hsa-miR-3689a-3p CLIP-seq
MIRT997708 hsa-miR-3689c CLIP-seq
MIRT997709 hsa-miR-4446-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000795 Component Synaptonemal complex IEA
GO:0000795 Component Synaptonemal complex ISS
GO:0001650 Component Fibrillar center IDA
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity ISS
GO:0005515 Function Protein binding IPI 16189514, 25036637, 25416956, 25910212, 26567527, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781, 35156780
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604839 3722 ENSG00000077800
Protein
UniProt ID O75344
Protein name Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (Inactive PPIase FKBP6) (36 kDa FK506-binding protein) (36 kDa FKBP) (FKBP-36) (FK506-binding protein 6) (FKBP-6) (Immunophilin FKBP36)
Protein function Has an essential role in spermatogenesis (PubMed:36150389). It is required to repress transposable elements and prevent their mobilization, which is essential for the germline integrity (By similarity). Acts via the piRNA metabolic process, whic
PDB 3B7X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00254 FKBP_C 48 140 FKBP-type peptidyl-prolyl cis-trans isomerase Domain
Tissue specificity TISSUE SPECIFICITY: Detected in all tissues examined, with higher expression in testis, heart, skeletal muscle, liver, and kidney.
Sequence
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGT
LGCPPLIPPNTTVLFEIELL
DFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALC
YGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASCY
RDYVDKEKEMWHRMFAPCGDGSTAGES
Sequence length 327
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Spermatogenic Failure spermatogenic failure 77 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 38092774
Heart Defects Congenital Associate 22318994
Multiple Sclerosis Associate 29873607
Neoplasms Associate 24241165
Uterine Cervical Dysplasia Associate 24241165
Uterine Cervical Neoplasms Associate 24241165