Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8468
Gene name Gene Name - the full gene name approved by the HGNC.	FKBP prolyl isomerase family member 6 (inactive)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FKBP6
Synonyms (NCBI Gene) Gene synonyms aliases	FKBP36, SPGF77
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cis-trans peptidyl-prolyl isomerase that may function in immunoregulation and basic cellular processes involving protein folding and trafficking. This gene is located in a chromosomal region that is deleted in William

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments
MIRT997705	hsa-miR-3192	CLIP-seq
MIRT997706	hsa-miR-3199	CLIP-seq
MIRT997707	hsa-miR-3689a-3p	CLIP-seq
MIRT997708	hsa-miR-3689c	CLIP-seq
MIRT997709	hsa-miR-4446-3p	CLIP-seq
MIRT997710	hsa-miR-4492	CLIP-seq
MIRT997711	hsa-miR-4498	CLIP-seq
MIRT997712	hsa-miR-4505	CLIP-seq
MIRT997713	hsa-miR-4515	CLIP-seq
MIRT997714	hsa-miR-4699-3p	CLIP-seq
MIRT997715	hsa-miR-4728-5p	CLIP-seq
MIRT997716	hsa-miR-762	CLIP-seq
MIRT2465297	hsa-miR-140-3p	CLIP-seq
MIRT2465298	hsa-miR-3134	CLIP-seq
MIRT2465299	hsa-miR-4434	CLIP-seq
MIRT2465300	hsa-miR-4516	CLIP-seq
MIRT2465301	hsa-miR-4531	CLIP-seq
MIRT2465302	hsa-miR-4534	CLIP-seq
MIRT2465303	hsa-miR-589	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000795	Component	Synaptonemal complex	IEA
GO:0000795	Component	Synaptonemal complex	ISS
GO:0001650	Component	Fibrillar center	IDA
GO:0003755	Function	Peptidyl-prolyl cis-trans isomerase activity	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 25036637, 25416956, 25910212, 26567527, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781, 35156780
GO:0005528	Function	FK506 binding	TAS	9782077
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	ISS
GO:0006457	Process	Protein folding	TAS	9782077
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0030154	Process	Cell differentiation	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	ISS
GO:0034587	Process	PiRNA processing	IBA
GO:0034587	Process	PiRNA processing	IEA
GO:0034587	Process	PiRNA processing	ISS
GO:0042802	Function	Identical protein binding	IPI	26567527, 32296183
GO:0045070	Process	Positive regulation of viral genome replication	IMP	26567527
GO:0045171	Component	Intercellular bridge	IDA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051321	Process	Meiotic cell cycle	ISS
GO:0051879	Function	Hsp90 protein binding	IBA
GO:0051879	Function	Hsp90 protein binding	IEA
GO:0051879	Function	Hsp90 protein binding	ISS
GO:0141196	Process	Transposable element silencing by piRNA-mediated DNA methylation	IEA
GO:0141196	Process	Transposable element silencing by piRNA-mediated DNA methylation	ISS

MIM	HGNC	e!Ensembl
604839	3722	ENSG00000077800

Protein

UniProt ID

O75344

Protein name

Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (Inactive PPIase FKBP6) (36 kDa FK506-binding protein) (36 kDa FKBP) (FKBP-36) (FK506-binding protein 6) (FKBP-6) (Immunophilin FKBP36)

Protein function

Has an essential role in spermatogenesis (PubMed:36150389). It is required to repress transposable elements and prevent their mobilization, which is essential for the germline integrity (By similarity). Acts via the piRNA metabolic process, whic

PDB

3B7X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00254	FKBP_C	48 → 140	FKBP-type peptidyl-prolyl cis-trans isomerase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in all tissues examined, with higher expression in testis, heart, skeletal muscle, liver, and kidney.

Sequence

MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVK
YSGYLEHMDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGT
LGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNY
LFRQNRFYDAKVRYKRALLLLRRRSAPPEEQHLVEAAKLPVLLNLSFTYLKLDRPTIALC
YGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASCY
RDYVDKEKEMWHRMFAPCGDGSTAGES

Sequence length

327

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Spermatogenic Failure	spermatogenic failure 77	N/A	N/A	GenCC

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Colorectal Neoplasms	Associate	38092774
Heart Defects Congenital	Associate	22318994
Multiple Sclerosis	Associate	29873607
Neoplasms	Associate	24241165
Uterine Cervical Dysplasia	Associate	24241165
Uterine Cervical Neoplasms	Associate	24241165

FKBP6 (FKBP prolyl isomerase family member 6 (inactive))