SPZ1 (spermatogenic leucine zipper 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 84654
Gene name Spermatogenic leucine zipper 1
Gene symbol SPZ1
Synonyms (NCBI Gene)
CILD38NYD-TSP1PPP1R148
Chromosome 5
Chromosome location 5q14.1
Summary This gene encodes a bHLH-zip transcription factor which functions in the mitogen-activate protein kinase (MAPK) signaling pathway. Because of its role in the upregulation of cell proliferation and tumorigenesis, this gene may serve as a target for Ras-ind
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT019357 hsa-miR-148b-3p Microarray 17612493
MIRT1387442 hsa-miR-3171 CLIP-seq
MIRT1387443 hsa-miR-3668 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (7)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
GO:0005515 Function Protein binding IPI 25416956, 28514442, 31515488, 32296183, 33961781, 35140242
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618068 30721 ENSG00000164299
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXG8
Protein name Spermatogenic leucine zipper protein 1 (Testis-specific protein 1) (Testis-specific protein NYD-TSP1)
Protein function Transcription factor that binds to the DNA sequence 5'-CANNTG-3'(E box) and the G-box motif. May play an important role in the regulation of cell proliferation and differentiation during spermatogenesis (By similarity).
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically and strongly expressed in the testis. Expressed in several tumor cell lines. {ECO:0000269|PubMed:12778315, ECO:0000269|PubMed:15899793}.
Sequence 
MASSAKSAEMPTISKTVNPTPDPHQEYLDPRITIALFEIGSHSPSSWGSLPFLKNSSHQV
TEQQTAQKFNNLLKEIKDILKNMAGFEEKITEAKELFEETNITEDVSAHKENIRGLDKIN
EMLSTNLPVSLAPEKEDNEKKQEMILETNITEDVSAHKENIRGLDKINEMLSTNLPVSLA
PEKEDNEKKQQMIMENQNSENTAQVFARDLVNRLEEKKVLNETQQSQEKAKNRLNVQEET
MKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKSQKDISETLGNNGVGFQTQPNNEVSAK
HELEEQVKKLSHDTYSLQLMAALLENECQILQQRVEILKELHHQKQGTLQEKPIQINYKQ
DKKNQKPSEAKKVEMYKQNKQAMKGTFWKKDRSCRSLDVCLNKKACNTQFNIHVARKALR
GKMRSASSLR
Sequence length 430
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CANCER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (8)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinogenesis Associate 28368406
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 28368406
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 32686686, 35627192
★★★★★
★☆☆☆☆
Found in Text Mining only
Glioma Associate 34076982
★★★★★
★☆☆☆☆
Found in Text Mining only
Infertility Male Associate 16759931
★★★★★
★☆☆☆☆
Found in Text Mining only
Myocardial Infarction Associate 29381915
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 28368406
★★★★★
★☆☆☆☆
Found in Text Mining only
Testicular Neoplasms Associate 35627192
★★★★★
★☆☆☆☆
Found in Text Mining only