Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8456
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box N1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXN1
Synonyms (NCBI Gene) Gene synonyms aliases
FKHL20, RONU, TIDAND, TLIND, WHN
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
Mutations in the winged-helix transcription factor gene at the nude locus in mice and rats produce the pleiotropic phenotype of hairlessness and athymia, resulting in a severely compromised immune system. This gene is orthologous to the mouse and rat gene
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34814444 T>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Genic downstream transcript variant, downstream transcript variant, coding sequence variant, intron variant, missense variant
rs104894562 C>T Pathogenic Stop gained, coding sequence variant
rs797046135 C>T Likely-pathogenic Genic upstream transcript variant, missense variant, upstream transcript variant, coding sequence variant, intron variant
rs886043619 TGTCCGCCCCCTGGGCTGTCCGGCTCAGGCC>- Likely-pathogenic Frameshift variant, coding sequence variant, intron variant
rs1064793129 CCCCCTGGGCTGTCCG>- Likely-pathogenic, pathogenic, uncertain-significance Frameshift variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT438125 hsa-miR-18b-5p Flow, Luciferase reporter assay, qRT-PCR, Western blot 24383669
MIRT438125 hsa-miR-18b-5p Flow, Luciferase reporter assay, qRT-PCR, Western blot 24383669
MIRT438123 hsa-miR-518b Flow, Luciferase reporter assay, qRT-PCR, Western blot 24383669
MIRT438123 hsa-miR-518b Flow, Luciferase reporter assay, qRT-PCR, Western blot 24383669
MIRT438125 hsa-miR-18b-5p Flow, Luciferase reporter assay, qRT-PCR, Western blot 24383669
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600838 12765 ENSG00000109101
Protein
UniProt ID O15353
Protein name Forkhead box protein N1 (Winged-helix transcription factor nude)
Protein function Transcriptional regulator which regulates the development, differentiation, and function of thymic epithelial cells (TECs) both in the prenatal and postnatal thymus. Acts as a master regulator of the TECs lineage development and is required from
PDB 5OCN , 6EL8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 270 357 Forkhead domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in thymus.
Sequence
MVSLPPPQSDVTLPGPTRLEGERQGDLMQAPGLPGSPAPQSKHAGFSCSSFVSDGPPERT
PSLPPHSPRIASPGPEQVQGHCPAGPGPGPFRLSPSDKYPGFGFEEAAASSPGRFLKGSH
APFHPYKRPFHEDVFPEAETTLALKGHSFKTPGPLEAFEEIPVDVAEAEAFLPGFSAEAW
CNGLPYPSQEHGPQVLGSEVKVKPPVLESGAGMFCYQPPLQHMYCSSQPPFHQYSPGGGS
YPIPYLGSSHYQYQRMAPQASTDGHQPLFPKPIYSYSILIFMALKNSKTGSLPVSEIYNF
MTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKSGSSSRKGCLWALNPAKIDKMQ
EEL
QKWKRKDPIAVRKSMAKPEELDSLIGDKREKLGSPLLGCPPPGLSGSGPIRPLAPPAGLS
PPLHSLHPAPGPIPGKNPLQDLLMGHTPSCYGQTYLHLSPGLAPPGPPQPLFPQPDGHLE
LRAQPGTPQDSPLPAHTPPSHSAKLLAEPSPARTMHDTLLPDGDLGTDLDAINPSLTDFD
FQGNLWEQLKDDSLALDPLVLVTSSPTSSSMPPPQPPPHCFPPGPCLTETGSGAGDLAAP
GSGGSGALGDLHLTTLYSAFMELEPTPPTAPAGPSVYLSPSSKPVALA
Sequence length 648
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Lymphoblastic Leukemia T-cell immunodeficiency, congenital alopecia, and nail dystrophy rs104894562, rs1597566470, rs2069729948, rs1597566699, rs2070018439, rs1057524466, rs1597567692, rs745708044, rs1064796115, rs1597567985, rs1169577591, rs1064795660, rs1438890364, rs1064793129, rs1288977950
View all (10 more)
N/A
severe combined immunodeficiency disease Severe combined immunodeficiency disease rs104894562 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
autism Autism N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alopecia universalis Associate 22590644
Autistic Disorder Associate 30755392
Carcinoma Hepatocellular Associate 28662289
Carcinoma Squamous Cell Stimulate 39628682
Dermatofibrosarcoma Associate 23614918
Developmental Disabilities Associate 30755392
Hepatitis B Associate 28662289
Hereditary renal agenesis Associate 22590644
Histiocytoma Benign Fibrous Associate 23614918
Immune System Diseases Associate 30755392