ACRBP (acrosin binding protein)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84519
Gene name Gene Name - the full gene name approved by the HGNC.
Acrosin binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ACRBP
Synonyms (NCBI Gene) Gene synonyms aliases
CT23, OY-TES-1, SP32
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and con
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IBA 21873635
GO:0001669 Component Acrosomal vesicle ISS
GO:0001675 Process Acrosome assembly ISS
GO:0002080 Component Acrosomal membrane ISS
GO:0003674 Function Molecular_function ND
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608352 17195 ENSG00000111644
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NEB7
Protein name Acrosin-binding protein (Acrosin-binding protein, 60 kDa form) (Cancer/testis antigen 23) (CT23) (Cancer/testis antigen OY-TES-1) (Proacrosin-binding protein sp32) [Cleaved into: Acrosin-binding protein, mature form (Acrosin-binding protein, 32 kDa form,
Protein function [Acrosin-binding protein, mature form]: Acrosomal protein that maintains proacrosin (pro-ACR) as an enzymatically inactive zymogen in the acrosome. Involved also in the acrosome formation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07222 PBP_sp32 1 → 240 Proacrosin binding protein sp32 Family
Tissue specificity TISSUE SPECIFICITY: Expression restricted to testis in normal tissue. Expressed in a wide spectrum of cancers, including bladder, breast, liver, lung and colon cancers. {ECO:0000269|PubMed:11248070}.
Sequence 
MRKPAAGFLPSLLKVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTC
RLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCSNHVYYAKR
VLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELL
QSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQEEGQKQEEQEEEQEEEGKQEEGQGTKE
GREAVSQLQTDSEPKFHSESLSSNPSSFAPRVREVESTPMIMENIQELIRSAQEIDEMNE
IYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYMEEEILGFGKSV
CDSLGRRHMSTCALCDFCSLKLEQCHSEASLQRQQCDTSHKTPFVSPLLASQSLSIGNQV
GSPESGRFYGLDLYGGLHMDFWCARLATKGCEDVRVSGWLQTEFLSFQDGDFPTKICDTD
YIQYPNYCSFKSQQCLMRNRNRKVSRMRCLQNETYSALSPGKSEDVVLRWSQEFSTLTLG
QFG
Sequence length 543
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 17013881
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Carcinogenesis Associate 35463688
Carcinoma Hepatocellular Associate 26339343
Carcinoma Ovarian Epithelial Stimulate 34528758
Colorectal Neoplasms Associate 24294369
Infertility Associate 35463688
Liposarcoma Myxoid Associate 24457462
Neoplasm Metastasis Associate 38100550
Neoplasms Associate 20876808, 35463688, 38100550
Neoplasms Stimulate 26339343
Ovarian Neoplasms Associate 20876808, 34528758