ACRBP (acrosin binding protein)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 84519
Gene name Acrosin binding protein
Gene symbol ACRBP
Synonyms (NCBI Gene)
CT23OY-TES-1SP32
Chromosome 12
Chromosome location 12p13.31
Summary The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and con
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IBA
GO:0001669 Component Acrosomal vesicle IEA
GO:0001669 Component Acrosomal vesicle ISS
GO:0001675 Process Acrosome assembly IEA
GO:0001675 Process Acrosome assembly ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608352 17195 ENSG00000111644
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NEB7
Protein name Acrosin-binding protein (Acrosin-binding protein, 60 kDa form) (Cancer/testis antigen 23) (CT23) (Cancer/testis antigen OY-TES-1) (Proacrosin-binding protein sp32) [Cleaved into: Acrosin-binding protein, mature form (Acrosin-binding protein, 32 kDa form,
Protein function [Acrosin-binding protein, mature form]: Acrosomal protein that maintains proacrosin (pro-ACR) as an enzymatically inactive zymogen in the acrosome. Involved also in the acrosome formation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07222 PBP_sp32 1 → 240 Proacrosin binding protein sp32 Family
Tissue specificity TISSUE SPECIFICITY: Expression restricted to testis in normal tissue. Expressed in a wide spectrum of cancers, including bladder, breast, liver, lung and colon cancers. {ECO:0000269|PubMed:11248070}.
Sequence 
MRKPAAGFLPSLLKVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTC
RLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCSNHVYYAKR
VLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELL
QSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQEEGQKQEEQEEEQEEEGKQEEGQGTKE
GREAVSQLQTDSEPKFHSESLSSNPSSFAPRVREVESTPMIMENIQELIRSAQEIDEMNE
IYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYMEEEILGFGKSV
CDSLGRRHMSTCALCDFCSLKLEQCHSEASLQRQQCDTSHKTPFVSPLLASQSLSIGNQV
GSPESGRFYGLDLYGGLHMDFWCARLATKGCEDVRVSGWLQTEFLSFQDGDFPTKICDTD
YIQYPNYCSFKSQQCLMRNRNRKVSRMRCLQNETYSALSPGKSEDVVLRWSQEFSTLTLG
QFG
Sequence length 543
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neoplasm of brain risk factor rs1949067963 RCV001271078
Show/Hide Text Mining Associations (11)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 35463688
Carcinoma Hepatocellular Associate 26339343
Carcinoma Ovarian Epithelial Stimulate 34528758
Colorectal Neoplasms Associate 24294369
Infertility Associate 35463688
Liposarcoma Myxoid Associate 24457462
Neoplasm Metastasis Associate 38100550
Neoplasms Associate 20876808, 35463688, 38100550
Neoplasms Stimulate 26339343
Ovarian Neoplasms Associate 20876808, 34528758