Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84458
Gene name Gene Name - the full gene name approved by the HGNC.
Ligand dependent nuclear receptor corepressor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LCOR
Synonyms (NCBI Gene) Gene synonyms aliases
C10orf12, MLR2
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528])
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007027 hsa-miR-615-3p Luciferase reporter assay 21565892
MIRT016678 hsa-miR-425-5p Sequencing 20371350
MIRT018627 hsa-miR-335-5p Microarray 18185580
MIRT027215 hsa-miR-103a-3p Sequencing 20371350
MIRT027388 hsa-miR-101-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12535528
GO:0001222 Function Transcription corepressor binding IPI 29628311
GO:0003677 Function DNA binding IEA
GO:0003714 Function Transcription corepressor activity IDA 12535528
GO:0005515 Function Protein binding IPI 20211142, 25416956, 27705803, 28514442, 29628311, 31041561, 31515488, 32296183, 33961781, 35016035, 35271311
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607698 29503 ENSG00000196233
Protein
UniProt ID Q96JN0
Protein name Ligand-dependent corepressor (LCoR) (Mblk1-related protein 2)
Protein function May act as transcription activator that binds DNA elements with the sequence 5'-CCCTATCGATCGATCTCTACCT-3' (By similarity). Repressor of ligand-dependent transcription activation by target nuclear receptors. Repressor of ligand-dependent transcri
PDB 2COB , 6V3X , 6V3Y
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05225 HTH_psq 350 395 helix-turn-helix, Psq domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12535528}.
Sequence
MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMAD
QDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSHSPGCSSTQGNGRPGRPSQYR
PDGLRSGDGVPPRSLQDGTREGFGHSTSLKVPLARSLQISEELLSRNQLSTAASLGPSGL
QNHGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQD
GKKDVSHSSPVDLKIPQVRGMDLSWESRTGDQYSYSSLVMGSQTESALSKKLRAILPKQS
RKSMLDAGPDSWGSDAEQSTSGQPYPTSDQEGDPGSKQPRKKRGRYRQYNSEILEEAISV
VMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKN
PPKKKMKLMRSEGPDVSVKIELDPQ
GEAAQSANESKNE
Sequence length 433
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Polycomb repressive complex  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32699331
Breast Neoplasms Associate 19744932, 32157438
Carcinogenesis Associate 32157438
Colorectal Neoplasms Associate 29453334
Endometrial Neoplasms Associate 34410950
Hypertension Portal Associate 21565892
Neoplasms Associate 34410950
Oculocutaneous albinism type 2 Stimulate 32157438
Prostatic Neoplasms Associate 22277651, 32157438
Uterine Cervical Dysplasia Associate 32157438