Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84440
Gene name Gene Name - the full gene name approved by the HGNC.
RAB11 family interacting protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RAB11FIP4
Synonyms (NCBI Gene) Gene synonyms aliases
FIP4-Rab11, RAB11-FIP4
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene interacts with RAB11 and is thought to be involved in bringing recycling endosome membranes to the cleavage furrow in late cytokinesis. Hypoxic conditions can lead to an upregulation of the encoded protein and enhance the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT710816 hsa-miR-3120-5p HITS-CLIP 19536157
MIRT710815 hsa-miR-431-5p HITS-CLIP 19536157
MIRT710814 hsa-miR-4326 HITS-CLIP 19536157
MIRT710813 hsa-miR-3157-5p HITS-CLIP 19536157
MIRT710812 hsa-miR-6888-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003407 Process Neural retina development IEA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 12470645, 16148947, 17030804, 22522702, 32296183
GO:0005615 Component Extracellular space HDA 22664934
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611999 30267 ENSG00000131242
Protein
UniProt ID Q86YS3
Protein name Rab11 family-interacting protein 4 (FIP4-Rab11) (Rab11-FIP4) (Arfophilin-2)
Protein function Acts as a regulator of endocytic traffic by participating in membrane delivery. Required for the abscission step in cytokinesis, possibly by acting as an 'address tag' delivering recycling endosome membranes to the cleavage furrow during late cy
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09457 RBD-FIP 596 636 FIP domain Motif
Tissue specificity TISSUE SPECIFICITY: Present at high level in testis (at protein level). Weakly expressed in other tissues. {ECO:0000269|PubMed:12857874}.
Sequence
MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKY
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPT
FADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLG
GLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRT
NVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPN
RKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLT
NGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVE
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMD
KLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREV
ELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDEL
MEALKEQEEINFRLRQYMDKIILAILDHNPSILEIK
H
Sequence length 637
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Endocytosis  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Keratoconus Keratoconus N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 28800327
Neoplasm Metastasis Associate 28035375
Neoplasms Associate 26015570
Neoplasms Stimulate 28035375
Pancreatic Neoplasms Associate 28035375