Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8440
Gene name Gene Name - the full gene name approved by the HGNC.
NCK adaptor protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NCK2
Synonyms (NCBI Gene) Gene synonyms aliases
GRB4, NCKbeta
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021929 hsa-miR-128-3p Microarray 17612493
MIRT036831 hsa-miR-877-3p CLASH 23622248
MIRT297070 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT707144 hsa-miR-648 HITS-CLIP 21572407
MIRT297079 hsa-miR-5692b HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0001771 Process Immunological synapse formation IEA
GO:0001784 Function Phosphotyrosine residue binding IPI 20624904
GO:0005515 Function Protein binding IPI 10026169, 10574708, 12074588, 12110186, 12606549, 15350535, 15721255, 15764601, 16189514, 16273093, 16337946, 16752908, 17617578, 18086875, 18539162, 19807924, 21516116, 22074159, 23455922, 24338975, 24728074, 24902122, 25416956, 25814554, 25910212, 26871637, 28514442, 29892012, 315
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604930 7665 ENSG00000071051
Protein
UniProt ID O43639
Protein name Cytoplasmic protein NCK2 (Growth factor receptor-bound protein 4) (NCK adaptor protein 2) (Nck-2) (SH2/SH3 adaptor protein NCK-beta)
Protein function Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in ELK1-dependent transcri
PDB 1U5S , 1WX6 , 1Z3K , 2B86 , 2CIA , 2FRW , 2FRY , 2JXB , 4E6R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 8 53 SH3 domain Domain
PF14604 SH3_9 118 166 Variant SH3 domain Domain
PF00018 SH3_1 201 249 SH3 domain Domain
PF00017 SH2 285 359 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVL
EEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPK
NYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHY
K
KAPIFTSEHGEKLYLVRALQ
Sequence length 380
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ErbB signaling pathway
Axon guidance
T cell receptor signaling pathway
Pathogenic Escherichia coli infection
  Downstream signal transduction
Nephrin family interactions
Ephrin signaling
VEGFA-VEGFR2 Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Hypertension Idiopathic intracranial hypertension N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 40528303
Celiac Disease Associate 27836013
Hypoxia Associate 29218693
Low Tension Glaucoma Associate 23349798
Melanoma Associate 15900300
Neoplasms Associate 29218693
Ovarian Neoplasms Associate 29218693
Personality Disorders Associate 29218693