CAVIN2 (caveolae associated protein 2)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 8436
Gene name Caveolae associated protein 2
Gene symbol CAVIN2
Synonyms (NCBI Gene)
PS-p68SDPRSDRcavin-2
Chromosome 2
Chromosome location 2q32.3
Summary This gene encodes a calcium-independent phospholipid-binding protein whose expression increases in serum-starved cells. This protein is a substrate for protein kinase C (PKC) phosphorylation and recruits polymerase I and transcript release factor (PTRF) t
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene Gene ontology Other IDs Protein
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0001786 Function Phosphatidylserine binding IDA 2390065, 10191091
GO:0005080 Function Protein kinase C binding IBA
GO:0005515 Function Protein binding IPI 19262564, 19525939, 19722192, 24013648, 24567387, 25416956, 32296183
GO:0005543 Function Phospholipid binding TAS 10191091
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
606728 10690 ENSG00000168497
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95810
Protein name Caveolae-associated protein 2 (Cavin-2) (PS-p68) (Phosphatidylserine-binding protein) (Serum deprivation-response protein)
Protein function Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae (PubMed:19525939). Plays a role in caveola formation in a tissue-specific manner. Required for the format
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15237 PTRF_SDPR 52 → 294 PTRF/SDPR family Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart and lung, and expressed at lower levels in brain, kidney, liver, pancreas, placenta, and skeletal muscle. {ECO:0000269|PubMed:10191091}.
Sequence 
MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLT
LLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRK
VSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAV
EGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVD
SLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK
KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKAT
SRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ
VHQTS
Sequence length 425
Interactions View interactions