Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	84329
Gene name	Hydrogen voltage gated channel 1
Gene symbol	HVCN1
Synonyms (NCBI Gene)	HV1VSOP
Chromosome	12
Chromosome location	12q24.11
Summary	This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody pro

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments
MIRT1057710	hsa-miR-101	CLIP-seq
MIRT1057711	hsa-miR-1183	CLIP-seq
MIRT1057712	hsa-miR-1227	CLIP-seq
MIRT1057713	hsa-miR-144	CLIP-seq
MIRT1057714	hsa-miR-186	CLIP-seq
MIRT1057715	hsa-miR-3064-3p	CLIP-seq
MIRT1057716	hsa-miR-3125	CLIP-seq
MIRT1057717	hsa-miR-3130-3p	CLIP-seq
MIRT1057718	hsa-miR-3137	CLIP-seq
MIRT1057719	hsa-miR-3647-3p	CLIP-seq
MIRT1057720	hsa-miR-3916	CLIP-seq
MIRT1057721	hsa-miR-4269	CLIP-seq
MIRT1057722	hsa-miR-4453	CLIP-seq
MIRT1057723	hsa-miR-4538	CLIP-seq
MIRT1057724	hsa-miR-4645-5p	CLIP-seq
MIRT1057725	hsa-miR-4673	CLIP-seq
MIRT1057726	hsa-miR-4733-3p	CLIP-seq
MIRT1057727	hsa-miR-4777-5p	CLIP-seq
MIRT1057728	hsa-miR-4793-3p	CLIP-seq
MIRT1057729	hsa-miR-518d-5p	CLIP-seq
MIRT1057730	hsa-miR-519b-5p	CLIP-seq
MIRT1057731	hsa-miR-519c-5p	CLIP-seq
MIRT1057732	hsa-miR-520c-5p	CLIP-seq
MIRT1057733	hsa-miR-526a	CLIP-seq
MIRT1057734	hsa-miR-767-5p	CLIP-seq
MIRT1057735	hsa-miR-342-5p	CLIP-seq
MIRT1057736	hsa-miR-4651	CLIP-seq
MIRT1057737	hsa-miR-4664-5p	CLIP-seq
MIRT1057738	hsa-miR-548a-5p	CLIP-seq
MIRT1057739	hsa-miR-548ab	CLIP-seq
MIRT1057740	hsa-miR-548ak	CLIP-seq
MIRT1057741	hsa-miR-548b-5p	CLIP-seq
MIRT1057742	hsa-miR-548c-5p	CLIP-seq
MIRT1057743	hsa-miR-548d-5p	CLIP-seq
MIRT1057744	hsa-miR-548h	CLIP-seq
MIRT1057745	hsa-miR-548i	CLIP-seq
MIRT1057746	hsa-miR-548j	CLIP-seq
MIRT1057747	hsa-miR-548k	CLIP-seq
MIRT1057748	hsa-miR-548l	CLIP-seq
MIRT1057749	hsa-miR-548w	CLIP-seq
MIRT1057750	hsa-miR-548y	CLIP-seq
MIRT1057751	hsa-miR-559	CLIP-seq
MIRT1057752	hsa-miR-562	CLIP-seq
MIRT1057753	hsa-miR-608	CLIP-seq
MIRT1057754	hsa-miR-885-3p	CLIP-seq
MIRT2245534	hsa-miR-106a	CLIP-seq
MIRT2245535	hsa-miR-106b	CLIP-seq
MIRT2245536	hsa-miR-17	CLIP-seq
MIRT2245537	hsa-miR-20a	CLIP-seq
MIRT2245538	hsa-miR-20b	CLIP-seq
MIRT1057717	hsa-miR-3130-3p	CLIP-seq
MIRT2245539	hsa-miR-3609	CLIP-seq
MIRT1057721	hsa-miR-4269	CLIP-seq
MIRT1057724	hsa-miR-4645-5p	CLIP-seq
MIRT1057725	hsa-miR-4673	CLIP-seq
MIRT1057726	hsa-miR-4733-3p	CLIP-seq
MIRT1057728	hsa-miR-4793-3p	CLIP-seq
MIRT2245540	hsa-miR-4796-3p	CLIP-seq
MIRT2245541	hsa-miR-519d	CLIP-seq
MIRT2245542	hsa-miR-544	CLIP-seq
MIRT2245543	hsa-miR-548ah	CLIP-seq
MIRT1057734	hsa-miR-767-5p	CLIP-seq
MIRT2245544	hsa-miR-93	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20144758, 22020278
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0009268	Process	Response to pH	IEA
GO:0009268	Process	Response to pH	ISS	16556803
GO:0010043	Process	Response to zinc ion	IDA	16554753
GO:0010043	Process	Response to zinc ion	IEA
GO:0010043	Process	Response to zinc ion	ISS	16556803
GO:0016020	Component	Membrane	IDA	16554753
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022843	Function	Voltage-gated monoatomic cation channel activity	EXP	18509058, 19805063
GO:0030171	Function	Voltage-gated proton channel activity	IBA
GO:0030171	Function	Voltage-gated proton channel activity	IDA	16554753, 22020278, 27859356, 30478045
GO:0030171	Function	Voltage-gated proton channel activity	IEA
GO:0030171	Function	Voltage-gated proton channel activity	IMP	20548053
GO:0030171	Function	Voltage-gated proton channel activity	ISS	16556803
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030670	Component	Phagocytic vesicle membrane	IDA	24415791
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0036126	Component	Sperm flagellum	IDA	20144758
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	18509058
GO:0042803	Function	Protein homodimerization activity	IDA	27859356
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0051453	Process	Regulation of intracellular pH	IEA
GO:0051453	Process	Regulation of intracellular pH	IMP	20548053
GO:0051453	Process	Regulation of intracellular pH	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060046	Process	Regulation of acrosome reaction	IDA	30478045
GO:0071294	Process	Cellular response to zinc ion	IDA	22020278
GO:0071467	Process	Cellular response to pH	IDA	22020278
GO:1902600	Process	Proton transmembrane transport	IBA
GO:1902600	Process	Proton transmembrane transport	IDA	22020278
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	ISS	16556803
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IDA	30478045
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA

MIM	HGNC	e!Ensembl
611227	28240	ENSG00000122986

Q96D96

Protein name

Voltage-gated hydrogen channel 1 (Hydrogen voltage-gated channel 1) (HV1) (Voltage sensor domain-only protein)

Protein function

Voltage-gated proton-selective channel that conducts outward proton currents in response to intracellular acidification. Lacks a canonical ion-channel pore domain and mediates proton permeability via its voltage sensor domain (PubMed:16554753, P

PDB

3A2A , 5OQK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00520	Ion_trans	98 → 231	Ion transport protein	Family
PF16799	VGPC1_C	226 → 273	C-terminal membrane-localisation domain of ion-channel, VCN1	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Enriched in immune tissues, such as lymph nodes, B-lymphocytes, monocytes and spleen (PubMed:16554753). Expressed in spermatozoa (PubMed:37669933). Expressed in respiratory epithelial cells (PubMed:20548053). {ECO:0000269|PubMed:165547

Sequence

MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPT
PVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAEL
ILDLKIIQPDKNNYAAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVV
SFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSERQLLRLKQMNVQLAA
KIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN

Sequence length

273

Interactions

View interactions

	Reactome
			ROS and RNS production in phagocytes Sperm Motility And Taxes Neutrophil degranulation

HVCN1 (hydrogen voltage gated channel 1)