Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84329
Gene name Gene Name - the full gene name approved by the HGNC.	Hydrogen voltage gated channel 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HVCN1
Synonyms (NCBI Gene) Gene synonyms aliases	HV1, VSOP
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody pro

Show/Hide all(63)

miRTarBase ID	miRNA	Experiments
MIRT1057710	hsa-miR-101	CLIP-seq
MIRT1057711	hsa-miR-1183	CLIP-seq
MIRT1057712	hsa-miR-1227	CLIP-seq
MIRT1057713	hsa-miR-144	CLIP-seq
MIRT1057714	hsa-miR-186	CLIP-seq
MIRT1057715	hsa-miR-3064-3p	CLIP-seq
MIRT1057716	hsa-miR-3125	CLIP-seq
MIRT1057717	hsa-miR-3130-3p	CLIP-seq
MIRT1057718	hsa-miR-3137	CLIP-seq
MIRT1057719	hsa-miR-3647-3p	CLIP-seq
MIRT1057720	hsa-miR-3916	CLIP-seq
MIRT1057721	hsa-miR-4269	CLIP-seq
MIRT1057722	hsa-miR-4453	CLIP-seq
MIRT1057723	hsa-miR-4538	CLIP-seq
MIRT1057724	hsa-miR-4645-5p	CLIP-seq
MIRT1057725	hsa-miR-4673	CLIP-seq
MIRT1057726	hsa-miR-4733-3p	CLIP-seq
MIRT1057727	hsa-miR-4777-5p	CLIP-seq
MIRT1057728	hsa-miR-4793-3p	CLIP-seq
MIRT1057729	hsa-miR-518d-5p	CLIP-seq
MIRT1057730	hsa-miR-519b-5p	CLIP-seq
MIRT1057731	hsa-miR-519c-5p	CLIP-seq
MIRT1057732	hsa-miR-520c-5p	CLIP-seq
MIRT1057733	hsa-miR-526a	CLIP-seq
MIRT1057734	hsa-miR-767-5p	CLIP-seq
MIRT1057735	hsa-miR-342-5p	CLIP-seq
MIRT1057736	hsa-miR-4651	CLIP-seq
MIRT1057737	hsa-miR-4664-5p	CLIP-seq
MIRT1057738	hsa-miR-548a-5p	CLIP-seq
MIRT1057739	hsa-miR-548ab	CLIP-seq
MIRT1057740	hsa-miR-548ak	CLIP-seq
MIRT1057741	hsa-miR-548b-5p	CLIP-seq
MIRT1057742	hsa-miR-548c-5p	CLIP-seq
MIRT1057743	hsa-miR-548d-5p	CLIP-seq
MIRT1057744	hsa-miR-548h	CLIP-seq
MIRT1057745	hsa-miR-548i	CLIP-seq
MIRT1057746	hsa-miR-548j	CLIP-seq
MIRT1057747	hsa-miR-548k	CLIP-seq
MIRT1057748	hsa-miR-548l	CLIP-seq
MIRT1057749	hsa-miR-548w	CLIP-seq
MIRT1057750	hsa-miR-548y	CLIP-seq
MIRT1057751	hsa-miR-559	CLIP-seq
MIRT1057752	hsa-miR-562	CLIP-seq
MIRT1057753	hsa-miR-608	CLIP-seq
MIRT1057754	hsa-miR-885-3p	CLIP-seq
MIRT2245534	hsa-miR-106a	CLIP-seq
MIRT2245535	hsa-miR-106b	CLIP-seq
MIRT2245536	hsa-miR-17	CLIP-seq
MIRT2245537	hsa-miR-20a	CLIP-seq
MIRT2245538	hsa-miR-20b	CLIP-seq
MIRT1057717	hsa-miR-3130-3p	CLIP-seq
MIRT2245539	hsa-miR-3609	CLIP-seq
MIRT1057721	hsa-miR-4269	CLIP-seq
MIRT1057724	hsa-miR-4645-5p	CLIP-seq
MIRT1057725	hsa-miR-4673	CLIP-seq
MIRT1057726	hsa-miR-4733-3p	CLIP-seq
MIRT1057728	hsa-miR-4793-3p	CLIP-seq
MIRT2245540	hsa-miR-4796-3p	CLIP-seq
MIRT2245541	hsa-miR-519d	CLIP-seq
MIRT2245542	hsa-miR-544	CLIP-seq
MIRT2245543	hsa-miR-548ah	CLIP-seq
MIRT1057734	hsa-miR-767-5p	CLIP-seq
MIRT2245544	hsa-miR-93	CLIP-seq

Show/Hide all(54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20144758, 22020278
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0009268	Process	Response to pH	IEA
GO:0009268	Process	Response to pH	ISS	16556803
GO:0010043	Process	Response to zinc ion	IDA	16554753
GO:0010043	Process	Response to zinc ion	IEA
GO:0010043	Process	Response to zinc ion	ISS	16556803
GO:0016020	Component	Membrane	IDA	16554753
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022843	Function	Voltage-gated monoatomic cation channel activity	EXP	18509058, 19805063
GO:0030171	Function	Voltage-gated proton channel activity	IBA
GO:0030171	Function	Voltage-gated proton channel activity	IDA	16554753, 22020278, 27859356, 30478045
GO:0030171	Function	Voltage-gated proton channel activity	IEA
GO:0030171	Function	Voltage-gated proton channel activity	IMP	20548053
GO:0030171	Function	Voltage-gated proton channel activity	ISS	16556803
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030670	Component	Phagocytic vesicle membrane	IDA	24415791
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031514	Component	Motile cilium	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0036126	Component	Sperm flagellum	IDA	20144758
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	18509058
GO:0042803	Function	Protein homodimerization activity	IDA	27859356
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0051453	Process	Regulation of intracellular pH	IEA
GO:0051453	Process	Regulation of intracellular pH	IMP	20548053
GO:0051453	Process	Regulation of intracellular pH	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060046	Process	Regulation of acrosome reaction	IDA	30478045
GO:0071294	Process	Cellular response to zinc ion	IDA	22020278
GO:0071467	Process	Cellular response to pH	IDA	22020278
GO:1902600	Process	Proton transmembrane transport	IBA
GO:1902600	Process	Proton transmembrane transport	IDA	22020278
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	ISS	16556803
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IDA	30478045
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA

MIM	HGNC	e!Ensembl
611227	28240	ENSG00000122986

Protein

UniProt ID

Q96D96

Protein name

Voltage-gated hydrogen channel 1 (Hydrogen voltage-gated channel 1) (HV1) (Voltage sensor domain-only protein)

Protein function

Voltage-gated proton-selective channel that conducts outward proton currents in response to intracellular acidification. Lacks a canonical ion-channel pore domain and mediates proton permeability via its voltage sensor domain (PubMed:16554753, P

PDB

3A2A , 5OQK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00520	Ion_trans	98 → 231	Ion transport protein	Family
PF16799	VGPC1_C	226 → 273	C-terminal membrane-localisation domain of ion-channel, VCN1	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Enriched in immune tissues, such as lymph nodes, B-lymphocytes, monocytes and spleen (PubMed:16554753). Expressed in spermatozoa (PubMed:37669933). Expressed in respiratory epithelial cells (PubMed:20548053). {ECO:0000269|PubMed:165547

Sequence

MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPT
PVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAEL
ILDLKIIQPDKNNYAAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVV
SFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSERQLLRLKQMNVQLAA
KIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN

Sequence length

273

Interactions

View interactions

	Reactome
			ROS and RNS production in phagocytes Sperm Motility And Taxes Neutrophil degranulation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	23940591
alpha 1 Antitrypsin Deficiency	Inhibit	34441020
Brain Damage Chronic	Associate	32461356
Cerebral Infarction	Associate	32461356, 34228044
Colorectal Neoplasms	Associate	23940591
Colorectal Neoplasms	Stimulate	24621823
Crohn Disease	Associate	23437289, 33936061
Inflammatory Bowel Diseases	Associate	23437289
Lymphoma Follicular	Associate	28064239, 30126979
Neoplasms	Associate	23940591, 32461356, 34228044, 40001460
Neuroinflammatory Diseases	Associate	34228044

HVCN1 (hydrogen voltage gated channel 1)