Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84289
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibitor of growth family member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ING5
Synonyms (NCBI Gene) Gene synonyms aliases
p28ING5
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q37.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a tumor suppressor protein that inhibits cell growth and induces apoptosis. This protein contains a PHD-type zinc finger. It interacts with tumor suppressor p53 and p300, a component of the histone acetyl transferase complex, suggesting
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT710937 hsa-miR-6769a-3p HITS-CLIP 19536157
MIRT710936 hsa-miR-1972 HITS-CLIP 19536157
MIRT710935 hsa-miR-4650-5p HITS-CLIP 19536157
MIRT710934 hsa-miR-3127-3p HITS-CLIP 19536157
MIRT710933 hsa-miR-6756-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
BRPF1 Unknown 18794358
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000123 Component Histone acetyltransferase complex IDA 16387653, 24065767
GO:0000123 Component Histone acetyltransferase complex IPI 16387653
GO:0001558 Process Regulation of cell growth IDA 22144582
GO:0001558 Process Regulation of cell growth ISS
GO:0003682 Function Chromatin binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608525 19421 ENSG00000168395
Protein
UniProt ID Q8WYH8
Protein name Inhibitor of growth protein 5 (p28ING5)
Protein function Component of the HBO1 complex, which specifically mediates acetylation of histone H3 at 'Lys-14' (H3K14ac) and, to a lower extent, acetylation of histone H4 (PubMed:24065767). Component of the MOZ/MORF complex which has a histone H3 acetyltransf
PDB 3C6W , 5ME8 , 5MTO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12998 ING 6 107 Inhibitor of growth proteins N-terminal histone-binding Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Down-regulated in bone marrow cells in acute myeloid leukemia patients as compared with normal bone marrow cells. {ECO:0000269|PubMed:21750715}.
Sequence
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARF
EADLKDKMEGSDF
ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP
VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    HATs acetylate histones
Regulation of TP53 Activity through Acetylation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 21731648
Epstein Barr Virus Infections Associate 21177815
Gastritis Atrophic Associate 30249557
Glioblastoma Associate 28925404
Hypoxia Associate 32206065
Klippel Trenaunay Weber Syndrome Associate 27901321
Leukemia Prolymphocytic T Cell Associate 29516674
Lung Neoplasms Inhibit 30810286, 37249332
Neoplasms Associate 21177815, 25860957, 28925404
Pulmonary Arterial Hypertension Associate 32206065