Gene Gene information from NCBI Gene database.
Entrez ID 84289
Gene name Inhibitor of growth family member 5
Gene symbol ING5
Synonyms (NCBI Gene)
p28ING5
Chromosome 2
Chromosome location 2q37.3
Summary This gene encodes a tumor suppressor protein that inhibits cell growth and induces apoptosis. This protein contains a PHD-type zinc finger. It interacts with tumor suppressor p53 and p300, a component of the histone acetyl transferase complex, suggesting
miRNA miRNA information provided by mirtarbase database.
586
miRTarBase ID miRNA Experiments Reference
MIRT710937 hsa-miR-6769a-3p HITS-CLIP 19536157
MIRT710936 hsa-miR-1972 HITS-CLIP 19536157
MIRT710935 hsa-miR-4650-5p HITS-CLIP 19536157
MIRT710934 hsa-miR-3127-3p HITS-CLIP 19536157
MIRT710933 hsa-miR-6756-3p HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
BRPF1 Unknown 18794358
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000123 Component Histone acetyltransferase complex IDA 16387653, 24065767
GO:0000123 Component Histone acetyltransferase complex IPI 16387653
GO:0001558 Process Regulation of cell growth IDA 22144582
GO:0001558 Process Regulation of cell growth ISS
GO:0003682 Function Chromatin binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608525 19421 ENSG00000168395
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WYH8
Protein name Inhibitor of growth protein 5 (p28ING5)
Protein function Component of the HBO1 complex, which specifically mediates acetylation of histone H3 at 'Lys-14' (H3K14ac) and, to a lower extent, acetylation of histone H4 (PubMed:24065767). Component of the MOZ/MORF complex which has a histone H3 acetyltransf
PDB 3C6W , 5ME8 , 5MTO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12998 ING 6 107 Inhibitor of growth proteins N-terminal histone-binding Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Down-regulated in bone marrow cells in acute myeloid leukemia patients as compared with normal bone marrow cells. {ECO:0000269|PubMed:21750715}.
Sequence
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQ
RVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARF
EADLKDKMEGSDF
ESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMP
VDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    HATs acetylate histones
Regulation of TP53 Activity through Acetylation