Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84286
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 175
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM175
Synonyms (NCBI Gene) Gene synonyms aliases
hTMEM175
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037472 hsa-miR-744-5p CLASH 23622248
MIRT719514 hsa-miR-181c-3p HITS-CLIP 19536157
MIRT719513 hsa-miR-6515-3p HITS-CLIP 19536157
MIRT719512 hsa-miR-1236-3p HITS-CLIP 19536157
MIRT719511 hsa-miR-585-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005267 Function Potassium channel activity IDA 28723891
GO:0005267 Function Potassium channel activity IEA
GO:0005515 Function Protein binding IPI 33505021, 37390818
GO:0005764 Component Lysosome IBA
GO:0005764 Component Lysosome IDA 26317472, 31261387, 31658403
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616660 28709 ENSG00000127419
Protein
UniProt ID Q9BSA9
Protein name Endosomal/lysosomal proton channel TMEM175 (Potassium channel TMEM175) (Transmembrane protein 175) (hTMEM175)
Protein function Proton-activated proton channel that catalyzes proton efflux from endosomes and lysosomes to maintain a steady-state pH (PubMed:35333573, PubMed:35750034, PubMed:37390818). Activated at low pH (under pH 4.6) by luminal side protons: selectively
PDB 6W8N , 6W8O , 6W8P , 6WC9 , 6WCA , 6WCB , 6WCC , 7LF6 , 7UNL , 7UNM , 8DHM , 8FY5 , 8FYF , 8VIC , 8VIE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06736 DUF1211 35 124 Protein of unknown function (DUF1211) Family
PF06736 DUF1211 260 356 Protein of unknown function (DUF1211) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:26317472}.
Sequence
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI
SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI
TFLP
YTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL
YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP
SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV
AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLP
LAYQ
QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF
AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA
RPEHPPPAPTGQDDPQSQLLPAPC
Sequence length 504
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Parkinson Disease Parkinson's disease N/A N/A GWAS
Parkinson disease Age of onset of parkinson disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 37328865, 37639066
Autonomic Nervous System Diseases Associate 34994165
Diffuse Neurofibrillary Tangles with Calcification Associate 35729600
Lewy Body Disease Associate 35729600
Multiple Sclerosis Associate 36279431
Parkinson Disease Associate 26601739, 30957308, 31261387, 33436766, 34148545, 34994165, 35750034, 36279431, 36609826, 37328865
REM Sleep Behavior Disorder Associate 32986685
Synucleinopathies Associate 32986685