Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84282
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 135
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF135
Synonyms (NCBI Gene) Gene synonyms aliases
L13, MMFD, REUL, Riplet
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs724159978 G>- Pathogenic, uncertain-significance 3 prime UTR variant, coding sequence variant, frameshift variant, downstream transcript variant, non coding transcript variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT642861 hsa-miR-3174 HITS-CLIP 23824327
MIRT642860 hsa-miR-4714-3p HITS-CLIP 23824327
MIRT642859 hsa-miR-1226-3p HITS-CLIP 23824327
MIRT642858 hsa-miR-6849-3p HITS-CLIP 23824327
MIRT642857 hsa-miR-939-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IDA 31006531
GO:0000209 Process Protein polyubiquitination IEA
GO:0002376 Process Immune system process IEA
GO:0004842 Function Ubiquitin-protein transferase activity EXP 17392790, 19017631, 19484123
GO:0004842 Function Ubiquitin-protein transferase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611358 21158 ENSG00000181481
Protein
UniProt ID Q8IUD6
Protein name E3 ubiquitin-protein ligase RNF135 (EC 2.3.2.27) (RIG-I E3 ubiquitin ligase) (REUL) (RING finger protein 135) (RING finger protein leading to RIG-I activation) (Riplet) (RING-type E3 ubiquitin transferase RNF135)
Protein function E2-dependent E3 ubiquitin-protein ligase that functions as a RIGI coreceptor in the sensing of viral RNAs in cell cytoplasm and the activation of the antiviral innate immune response (PubMed:19017631, PubMed:19484123, PubMed:21147464, PubMed:239
PDB 7JL1 , 7JL3 , 8G7T , 8G7U , 8G7V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15227 zf-C3HC4_4 21 62 Domain
PF00622 SPRY 312 427 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal muscle, spleen, kidney, placenta, prostate, stomach, thyroid and tongue. Also weakly expressed in heart, thymus, liver and lung. {ECO:0000269|PubMed:19017631}.
Sequence
MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACP
TC
RQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRP
ELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDL
SMASPKLVTSDTAAGKIRDILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPL
PDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTS
QVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAW
HMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLH
PGNYLII
KQVKV
Sequence length 432
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    DDX58/IFIH1-mediated induction of interferon-alpha/beta
Ovarian tumor domain proteases
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
TRAF6 mediated NF-kB activation
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
Negative regulators of DDX58/IFIH1 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Macrocephaly, Macrosomia, And Facial Dysmorphism Syndrome Macrocephaly, macrosomia, facial dysmorphism syndrome rs724159978 N/A
autism spectrum disorder Autism spectrum disorder rs724159978 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Overgrowth-Macrocephaly-Facial Dysmorphism Syndrome overgrowth-macrocephaly-facial dysmorphism syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 37108679
Carcinoma Hepatocellular Associate 37803338, 38154055, 39324668
Carcinoma Hepatocellular Inhibit 39766812
Cholangiocarcinoma Associate 39766812
Developmental Disabilities Associate 30665703
Glioma Associate 18492260
Neoplasm Metastasis Associate 36495591
Neoplasm Metastasis Inhibit 39766812
Neoplasms Inhibit 20844836, 37145209
Neoplasms Associate 36495591