Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Gene ontology Other IDs Protein Associated diseases
Entrez ID	84225
Gene name	Zinc finger MYND-type containing 15
Gene symbol	ZMYND15
Synonyms (NCBI Gene)	SPGF14
Chromosome	17
Chromosome location	17p13.2
Summary	This gene encodes a MYND-containing zinc-binding protein with a nuclear localization sequence. A similar gene in mice has been shown to act as a testis-specific transcriptional repressor by recruiting histone deacetylase enzymes to regulate spatiotemporal

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777432	AACA>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IBA
GO:0007286	Process	Spermatid development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
614312	20997	ENSG00000141497

Q9H091

Protein name

Zinc finger MYND domain-containing protein 15

Protein function

Acts as a transcriptional repressor through interaction with histone deacetylases (HDACs). May be important for spermiogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01753	zf-MYND	313 → 359	MYND finger	Domain

Sequence

MEFVSGYRDEFLDFTALLFGWFRKFVAERGAVGTSLEGRCRQLEAQIRRLPQDPALWVLH
VLPNHSVGISLGQGAEPGPGPGLGTAWLLGDNPPLHLRDLSPYISFVSLEDGEEGEEEEE
EDEEEEKREDGGAGSTEKVEPEEDRELAPTSRESPQETNPPGESEEAAREAGGGKDGCRE
DRVENETRPQKRKGQRSEAAPLHVSCLLLVTDEHGTILGIDLLVDGAQGTASWGSGTKDL
APWAYALLCHSMACPMGSGDPRKPRQLTVGDARLHRELESLVPRLGVKLAKTPMRTWGPR
PGFTFASLRARTCHVCHRHSFEAKLTPCPQCSAVLYCGEACLRADWQRCPDDVSHRFWCP
RLAAFMERAGELATLPFTYTAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGFSRHP
RGNTPSLSLLRGGDPYQLLQGDGTALMPPVPPHPPRGVFGSWQDYYTWRGLSLDSPIAVL
LTYPLTVYYVITHLVPQSFPELNIQNKQSLKIHVVEAGKEFDLVMVFWELLVLLPHVALE
LQFVGDGLPPESDEQHFTLQRDSLEVSVRPGSGISARPSSGTKEKGGRRDLQIKVSARPY
HLFQGPKPDLVIGFNSGFALKDTWLRSLPRLQSLRVPAFFTESSEYSCVMDGQTMAVATG
GGTSPPQPNPFRSPFRLRAADNCMSWYCNAFIFHLVYKPAQGSGARPAPGPPPPSPTPSA
PPAPTRRRRGEKKPGRGARRRK

Sequence length

742

Interactions

View interactions

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Non-obstructive azoospermia	Pathogenic	rs148161063	RCV001648514
Spermatogenic failure 14	Pathogenic	rs587777432, rs2150630821, rs752801920, rs1484755918	RCV000122741 RCV001374582 RCV001374583 RCV001449969

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Male infertility	Uncertain significance	rs1597285544	RCV001003418
ZMYND15-related disorder	Likely benign; Conflicting classifications of pathogenicity	rs752801920, rs373195825, rs1916373332, rs751659829, rs148980412	RCV003909436 RCV003917251 RCV003931955 RCV003944293 RCV003940587

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Azoospermia Nonobstructive	Associate	30054974
Spherocytosis Type 1	Associate	30054974

ZMYND15 (zinc finger MYND-type containing 15)