Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84189
Gene name Gene Name - the full gene name approved by the HGNC.
SLIT and NTRK like family member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLITRK6
Synonyms (NCBI Gene) Gene synonyms aliases
DFNMYP
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the SLITRK protein family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin re
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs74591375 C>A,T Benign-likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs587777069 G>A,T Pathogenic Stop gained, missense variant, coding sequence variant
rs587777070 G>T Pathogenic Stop gained, coding sequence variant
rs587777071 G>A Pathogenic Stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1369824 hsa-miR-3616-5p CLIP-seq
MIRT1369825 hsa-miR-3647-5p CLIP-seq
MIRT1369826 hsa-miR-4643 CLIP-seq
MIRT1369827 hsa-miR-466 CLIP-seq
MIRT1369828 hsa-miR-4789-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001964 Process Startle response IEA
GO:0002088 Process Lens development in camera-type eye IEA
GO:0002093 Process Auditory receptor cell morphogenesis IEA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 23543054
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609681 23503 ENSG00000184564
Protein
UniProt ID Q9H5Y7
Protein name SLIT and NTRK-like protein 6
Protein function Regulator of neurite outgrowth required for normal hearing and vision.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 143 195 Leucine rich repeat Repeat
PF13855 LRR_8 364 423 Leucine rich repeat Repeat
PF13855 LRR_8 411 471 Leucine rich repeat Repeat
PF13855 LRR_8 459 518 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: In adult brain, highly expressed in putamen with no expression in cerebral cortex. Expressed in adult and fetal lung and fetal liver. Also expressed at high levels in some brain tumors including medulloblastomas and primitive neuroecto
Sequence
MKLWIHLFYSSLLACISLHSQTPVLSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEIS
VPPSRPFQLSLLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHIN
HNSLEILKEDTFHGLENLEFLQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIF
RFVPLTHLDLRGNQL
QTLPYVGFLEHIGRILDLQLEDNKWACNCDLLQLKTWLENMPPQS
IIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKT
TSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRP
PPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNG
NHL
TKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFS
GVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNP
WDCSCDLVGLQQWIQKLSKNTV
TDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRS
LTDAVPLSVLILGLLIMFITIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSM
YGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRS
LLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIA
QLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ
T
Sequence length 841
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules   Receptor-type tyrosine-protein phosphatases
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
High Myopia-Sensorineural Deafness Syndrome high myopia-sensorineural deafness syndrome rs587777069, rs587777070, rs587777071 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Deafness hearing loss, autosomal recessive N/A N/A GenCC
hearing impairment Hearing impairment N/A N/A ClinVar
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Auditory neuropathy Associate 23946138
Deafness Associate 33187236
Hair Diseases Associate 23946138
Hearing Loss Associate 23946138
Myopia Associate 23946138
Neoplasms Associate 26317352
Pulmonary Disease Chronic Obstructive Associate 30361509
Respiratory Tract Infections Associate 26317352
Vestibulocochlear Nerve Diseases Associate 23946138