Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
84174
Gene name Gene Name - the full gene name approved by the HGNC.
Src like adaptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLA2
Synonyms (NCBI Gene) Gene synonyms aliases
C20orf156, MARS, SLAP-2, SLAP2
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018729 hsa-miR-335-5p Microarray 18185580
MIRT1351311 hsa-miR-1228 CLIP-seq
MIRT1351312 hsa-miR-1273f CLIP-seq
MIRT1351313 hsa-miR-1276 CLIP-seq
MIRT1351314 hsa-miR-1293 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11696592
GO:0005515 Function Protein binding IPI 11891219, 16273093, 24728074, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm TAS 11696592
GO:0005770 Component Late endosome IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606577 17329 ENSG00000101082
Protein
UniProt ID Q9H6Q3
Protein name Src-like-adapter 2 (Modulator of antigen receptor signaling) (MARS) (Src-like adapter protein 2) (SLAP-2)
Protein function Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a C
PDB 4M4Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 38 84 SH3 domain Domain
PF00017 SH2 94 176 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in immune system, with highest levels in peripheral blood leukocytes. Expressed in spleen, thymus and lymph nodes. Expressed in T-cells as well as in monocytes, and at low level in B-cells. Also detected in plac
Sequence
MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLT
IVSEDGDWWTVLSEVSGREYNIPS
VHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHY
SELA
DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSEG
LRESLSFYISLNDEAVSLDDA
Sequence length 261
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Charcot-marie-tooth disease Autosomal dominant Charcot-Marie-Tooth disease type 2U rs137852739, rs137852737, rs118203972, rs118203974, rs267607183, rs267606878, rs121908287, rs1562648373, rs121908288, rs1368013631, rs28940291, rs28940292, rs28940293, rs28940294, rs28940295
View all (1137 more)
Pulmonary alveolar proteinosis Severe early-onset pulmonary alveolar proteinosis due to MARS deficiency rs756021768, rs1553549333, rs758523839
Spastic paraplegia Autosomal recessive spastic paraplegia type 70 rs118204049, rs121918262, rs104894490, rs119476046, rs281865117, rs281865118, rs137853017, rs72554620, rs121908610, rs121908611, rs121908613, rs116171274, rs121434442, rs121434443, rs137852520
View all (368 more)
Unknown
Disease term Disease name Evidence References Source
Carcinoma Carcinoma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Squamous Cell Carcinoma of Head and Neck Associate 37688682