Gene Gene information from NCBI Gene database.
Entrez ID 84174
Gene name Src like adaptor 2
Gene symbol SLA2
Synonyms (NCBI Gene)
C20orf156MARSSLAP-2SLAP2
Chromosome 20
Chromosome location 20q11.23
Summary This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein
miRNA miRNA information provided by mirtarbase database.
204
miRTarBase ID miRNA Experiments Reference
MIRT018729 hsa-miR-335-5p Microarray 18185580
MIRT1351311 hsa-miR-1228 CLIP-seq
MIRT1351312 hsa-miR-1273f CLIP-seq
MIRT1351313 hsa-miR-1276 CLIP-seq
MIRT1351314 hsa-miR-1293 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11696592
GO:0005515 Function Protein binding IPI 11891219, 16273093, 24728074, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm TAS 11696592
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606577 17329 ENSG00000101082
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H6Q3
Protein name Src-like-adapter 2 (Modulator of antigen receptor signaling) (MARS) (Src-like adapter protein 2) (SLAP-2)
Protein function Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a C
PDB 4M4Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 38 84 SH3 domain Domain
PF00017 SH2 94 176 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in immune system, with highest levels in peripheral blood leukocytes. Expressed in spleen, thymus and lymph nodes. Expressed in T-cells as well as in monocytes, and at low level in B-cells. Also detected in plac
Sequence
MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLT
IVSEDGDWWTVLSEVSGREYNIPS
VHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHY
SELA
DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSEG
LRESLSFYISLNDEAVSLDDA
Sequence length 261
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BASAL CELL CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Squamous Cell Carcinoma of Head and Neck Associate 37688682
★☆☆☆☆
Found in Text Mining only