Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8417
Gene name Gene Name - the full gene name approved by the HGNC.
Syntaxin 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STX7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a syntaxin family membrane receptor involved in vesicle transport. The encoded protein binds alpha-SNAP, an important regulator of transport vesicle fusion. Along with syntaxin 13, this protein plays a role in the order
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs864309676 T>G Likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005199 hsa-miR-30a-5p pSILAC 18668040
MIRT004164 hsa-miR-192-5p Microarray 16822819
MIRT024345 hsa-miR-215-5p Microarray 19074876
MIRT004164 hsa-miR-192-5p Microarray 19074876
MIRT005199 hsa-miR-30a-5p Proteomics;Other 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000149 Function SNARE binding IBA 21873635
GO:0000149 Function SNARE binding IDA 24550300
GO:0001772 Component Immunological synapse IDA 21438968
GO:0001916 Process Positive regulation of T cell mediated cytotoxicity IMP 21438968
GO:0005484 Function SNAP receptor activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603217 11442 ENSG00000079950
Protein
UniProt ID O15400
Protein name Syntaxin-7
Protein function May be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. Mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14523 Syntaxin_2 18 119 Syntaxin-like protein Domain
PF05739 SNARE 201 253 SNARE domain Family
Tissue specificity TISSUE SPECIFICITY: Highest expression is found in placenta followed by heart, skeletal muscle, kidney and brain. Low expression is found in pancreas, lung and liver.
Sequence
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFV
A
RVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI
IILILVIGVAIIS
LIIWGLNH
Sequence length 261
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  SNARE interactions in vesicular transport
Autophagy - animal
Phagosome
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Infantile spasms Infantile Spasm rs387906686, rs1553579488, rs1553567561 26395554
Associations from Text Mining
Disease Name Relationship Type References
Hypoalphalipoproteinemias Associate 32541515
Kidney Neoplasms Associate 30075554
Leprosy Associate 38224943
Malformations of Cortical Development Associate 26395554
Nasopharyngeal Carcinoma Associate 32541515
Schizophrenia Associate 15329799